KEGG   Scleropages formosus (Asian bonytongue): 114909094
Entry
114909094         CDS       T04919                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
sfm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114909094
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114909094
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sfm04030]
    114909094
G protein-coupled receptors [BR:sfm04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    114909094
SSDB
Motif
Pfam: 7tm_1 DUF1634
Other DBs
NCBI-GeneID: 114909094
NCBI-ProteinID: XP_029113647
LinkDB
Position
1
AA seq 369 aa
MAIESNQVSQCYDNQTVEFFYNKSGKFISPMWRTRDFVVVGLGLTVCVIVILANILVMTA
IIINRRFHYPIYYLLGNLAAADLFAGLAYLHLMFHTGPWTIRLTPYRWFLRQGLIDTSLT
ASVVNLLAVALERHQTIFTMQLHSTMSVRRVLLLILAIWTVAVLLGLVPTMGWHCLCNLP
ACSTMAPMYSRSYLVFWAVLNLLTFSIMVAVYTRIFWYVRHKSRRMSQHTTNARYRETVM
SLMKTVTMILGAFVICWTPGLVVLLLDGLHCIPCQVLKYEKYCLVLAECNSLMNPIIYSY
RDEDMRRTFKRILCSLCGRGRGRHWGTVSGIRFNTQEEEGDQSHDADRVTNGTRLMLTDG
RDMLSSSEG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggccattgagtcgaaccaggtgtcccagtgctacgacaaccaaactgtggagttcttc
tataacaagagcggcaagttcatcagccccatgtggcgaacacgtgactttgtcgtggtg
ggactaggcctcacggtgtgtgtgatcgtcatcctcgccaacatccttgtcatgaccgct
ataatcatcaaccgccgcttccactaccccatctactacctgttgggtaacctggcagca
gcagacctctttgctggcctcgcctacctgcacctcatgttccacacaggtccctggacc
atacgattaaccccataccgttggttcctgcgccaaggcctcattgacacgagcctcaca
gcatctgttgtgaacctgctcgctgttgccttggagcgccaccagaccatttttaccatg
cagctgcacagcaccatgagtgtccgtcgtgtcctcctgcttatcctggccatctggacc
gtagctgttctgctcggcctggtgcctaccatgggctggcactgcttgtgtaacctgcct
gcctgctccaccatggcacccatgtacagccgcagctacctggtcttctgggccgtgctc
aacctgctcaccttctccatcatggtggccgtttacacgcgcatcttctggtatgtgcgc
cacaagagccggcgtatgtcgcagcacaccacaaatgccagataccgggagactgtgatg
agcctcatgaagacagtcaccatgatcctgggagcctttgtgatctgctggacacctggc
cttgttgtgttgctgctggatgggctccactgcatcccctgccaggtgctcaagtatgag
aagtactgtctagttctggcagagtgcaactcgctcatgaaccccatcatctactcatac
cgcgacgaagatatgaggcgtaccttcaagcgcatcttgtgctccctgtgcgggagagga
cgggggcgccactgggggacagtctcggggatccgcttcaacactcaggaggaagagggg
gaccagagccacgatgctgaccgtgtgacaaacggcacccgcctcatgctgaccgatggg
agggatatgctctcctcctctgaaggctga

DBGET integrated database retrieval system