KEGG   Shigella flexneri 2003036: SFy_1070Help
Entry
SFy_1070          CDS       T03267                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase, fraction A; penicillin-binding protein 5; D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00550  Peptidoglycan biosynthesis
sfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SFy_1070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfn01002]
    SFy_1070
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfn01011]
    SFy_1070
Enzymes [BR:sfn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SFy_1070
Peptidases and inhibitors [BR:sfn01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SFy_1070
Peptidoglycan biosynthesis and degradation proteins [BR:sfn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SFy_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13 PBP5_C
Motif
Other DBs
NCBI-ProteinID: AIL34778
LinkDB All DBs
Position
804389..805360
Genome map
AA seq 323 aa AA seqDB search
MAFMTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILMDYASGKVLAEGN
ADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGD
QVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDA
PGQFSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTG
TTAGAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATF
VTQRVWFGDKIEVNLGAGEAGSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttatgacgcaatactcctctctccttcgtggtcttgcagcgggttctgcattt
ttattcctttttgccccaacggcattcgcggccgaacaaaccgttgaagcgccgagcgtg
gatgcgcgtgcatggattttaatggattacgccagcggtaaagtgctggcagaaggcaat
gcggatgagaaactggatcctgcgagcctgactaaaatcatgaccagctatgtggttggg
caggcgcttaaggccgataagattaaactcaccgatatggtgacggtcggtaaagatgcc
tgggcgacgggaaatccggcactgcgtggttcatcggtaatgttcctcaaaccgggcgat
caggtttcggtggcagacttgaacaaaggtgtgattatccagtccggtaatgacgcctgt
attgcgctggcagattacgttgccgggagccaggagtcctttattggtctgatgaatggt
tatgccaaaaaactggggctgaccaacactaccttccagacggtgcacggcctggatgcg
ccggggcagttcagtaccgcgcgcgatatggcattgctgggtaaagcattgatccacgat
gtgccggaagagtacgccattcataaagagaaagagttcaccttcaacaaaattcgtcag
cctaaccgtaaccgtctgctgtggagcagcaatctgaatgttgatggcatgaagacagga
accacggcaggtgcgggatataatctggttgcttcggctacccagggtgatatgcgttta
atctccgtagtgctgggggcgaaaactgaccgtatccgttttaatgagtctgagaaatta
ttgacctggggtttccgcttctttgaaactgtgacgccaattaaacctgatgccaccttt
gtgactcagcgcgtctggtttggtgataagatcgaagtgaatctcggggcaggcgaagcg
ggctccgtgtga

DBGET integrated database retrieval system