KEGG   Shigella flexneri 2003036: SFy_1876Help
Entry
SFy_1876          CDS       T03267                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00250  Alanine, aspartate and glutamate metabolism
sfn00410  beta-Alanine metabolism
sfn00640  Propanoate metabolism
sfn00650  Butanoate metabolism
sfn01100  Metabolic pathways
sfn01120  Microbial metabolism in diverse environments
Module
sfn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SFy_1876
   00650 Butanoate metabolism
    SFy_1876
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFy_1876
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFy_1876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfn01007]
    SFy_1876
Enzymes [BR:sfn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SFy_1876
Amino acid related enzymes [BR:sfn01007]
 Aminotransferase (transaminase)
  Class III
   SFy_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIL35413
LinkDB All DBs
Position
1381895..1383160
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINTLAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGECGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggcagaaaacgctacgctgaaggacgtagagggcaac
gaatacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaattgcaacagtttacccacacggcgtatcagattgtg
ccgtacgaaagctacgtcacgctggcggagaaaattaacacccttgccccagtgagcggg
caggctaaaaccgcattcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgacctggcgtgattgcgtttagcggtggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtcgcg
gccattattttcgaaccggtgcagggcgagtgcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system