KEGG   Shigella flexneri 2003036: SFy_5122Help
Entry
SFy_5122          CDS       T03267                                 

Definition
(GenBank) Glutamate decarboxylase alpha
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00250  Alanine, aspartate and glutamate metabolism
sfn00410  beta-Alanine metabolism
sfn00430  Taurine and hypotaurine metabolism
sfn00650  Butanoate metabolism
sfn01100  Metabolic pathways
sfn01110  Biosynthesis of secondary metabolites
sfn01120  Microbial metabolism in diverse environments
sfn02024  Quorum sensing
Module
sfn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SFy_5122
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFy_5122
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFy_5122
   00430 Taurine and hypotaurine metabolism
    SFy_5122
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SFy_5122
Enzymes [BR:sfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SFy_5122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIL37919
LinkDB All DBs
Position
3691319..3692719
Genome map
AA seq 466 aa AA seqDB search
MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKQ
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaagctgttaacggatttccgctcagaactactcgattcacgttttggcgca
aaggccatttctactatcgcggagtcaaaacgatttccgctgcacgaaatgcgcgatgat
gtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgtcagaaccta
gccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcgatc
aataaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaatatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctagtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgtgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttccca
caaccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgctgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctgggtggtcaaattggtacttttgccatcaacttctcccgcccg
gcgggtcaggtaattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcctcttaccaggttgccgcttatctggcggatgaaatcgccaaacag
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system