KEGG   Chania multitudinisentens: Z042_10460Help
Entry
Z042_10460        CDS       T02987                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00564  Glycerophospholipid metabolism
sfo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Z042_10460 (glpD)
Enzymes [BR:sfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Z042_10460 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHG20013
UniProt: W0L869
LinkDB All DBs
Position
complement(1278943..1280451)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPGS
KGLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQKVVEHGGEVRTRTKVTRARRENG
LWIVEATDIDSGKTSIWRAKGLVNATGPWVKHFFDDGLQLKSPYGIRLIKGSHIVVPKAH
NQPQSYILQNEDHRIVFVIPWLDEFSIIGTTDVEYHGDPQDVKIDDNEIAYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDQGQAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGAGSAWTKNGSLPGGDIGGDRDSYAAKLRRQHGWLPESLARRYART
YGSHSELILANVASLSELGEDFGHGLYEAELNYLVEKEWVVELDDAIWRRTKLGMWLNAA
QQARVKAWLAEQAKTKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgttatcggtggcggtatcaatggtgctggcatcgcagca
gatgcggccgggcgcgggttatccgttctgctactggaagcccaagatttggcctgcgct
acgtcttccgccagttcaaaactgatccacggtggtctgcgctacctggaacactacgaa
ttccgcctggtgagtgaagcattggccgaacgtgaagtgctgctcaagctggcaccgcat
atcgccttcccgatgcgtttccgcctgccgcatcagccacatctgcgcccggcatggatg
attcgtaccggtctgttcctgtacgaccacttgggtaaacgcaccagcctgccgggcagt
aaaggtttgcgctttggaccagaatcagtgctgaagccggaattaaagcgcggtttcgaa
tattctgattgctgggtagacgatgctcgtctggtcgtcctgaatgcgcaaaaagtggtg
gaacatgggggggaagttcgcacccgcaccaaagttacccgtgcccggcgtgaaaatggc
ctgtggatagtggaagccaccgatatcgacagcggcaaaacctctatctggcgcgccaag
gggttggtcaatgccactggcccatgggtgaaacatttctttgacgatggcctgcaactc
aaatcaccttacggtatccgtttgatcaaaggcagccacattgtagtaccgaaagcgcat
aaccaaccgcagtcttatattctgcaaaacgaagatcaccgtatcgtgtttgttattcct
tggttggatgaattttccatcatcggtaccaccgatgtggaatatcacggcgatccacaa
gatgtgaagatcgacgacaatgaaatcgcctatctgctgaaagtgtataacgatcacttc
aagaaacagctgggccgtgacgatatcgtctggacttactccggcgtgcgcccgctgtgc
gatgacgaatcggactcaccgcaggcgatcacccgtgactacacgctggatgtgcatgat
gaccagggccaggccccgctgctttccgtgttcggcggcaaactcaccacttaccgcaag
ctggccgaacacgccatggagaaactggcgcactactacccaggcgctggttctgcgtgg
accaaaaacggttcactgcccggtggagatatcggtggcgatcgtgacagctatgccgcc
aagctgcgccgccaacatggctggctgccagaatcgctggctcgccgctatgcccgcact
tatggtagccatagcgaactgatcctggctaatgtggctagcttgagcgagctgggtgaa
gatttcggccacggtttatatgaagcggagctgaactatctggtggaaaaagagtgggtc
gttgagctggatgatgccatctggcgccgtaccaagctgggtatgtggctcaacgcagca
caacaggcgcgggtaaaagcctggctggcagaacaggcaaaaaccaaagcactgtcgctg
gcgtcttaa

DBGET integrated database retrieval system