KEGG   Chania multitudinisentens: Z042_12235Help
Entry
Z042_12235        CDS       T02987                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfo  Chania multitudinisentens
Brite
Enzymes [BR:sfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Z042_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHG20318
UniProt: W0L915
LinkDB All DBs
Position
872197..872820
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEALIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKTGTTLSGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGNKLAVVSTANQDSPLMGEAVAGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWNVVNWDEAAKRFNEAQK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttatgcttacgacgcactggaaccgcatttcgat
aagcagaccatggaaatccaccacaccaaacaccaccagacctatgtcaacaatgccaac
accgtgctggaagcttaccctgagctggcttcgttgagcgttgaagcgctgatccaggat
ctggataaagtacctgctgacaagcgcaccttcatgcgtaataacgcaggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgtcaggcgatctgaaa
gccgccattgagcgcgatttcggcagcgttgagaaattccaggaagagttcgagaaagcc
gccgccacccgtttcggctccggctgggcctggctggtactgaaaggtaacaagctggcc
gtggtttctaccgctaaccaagacagcccgttgatgggcgaagcggtagctggcgcttcc
ggtttcccgattatcggtctggatgtgtgggaacacgcctactacctgaaattccagaac
cgccgcccagattacatcaaggcgttctggaacgtggtgaactgggacgaagccgcaaaa
cgcttcaacgaagcacagaaataa

DBGET integrated database retrieval system