KEGG   Chania multitudinisentens: Z042_12310Help
Entry
Z042_12310        CDS       T02987                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00260  Glycine, serine and threonine metabolism
sfo00270  Cysteine and methionine metabolism
sfo00450  Selenocompound metabolism
sfo01100  Metabolic pathways
sfo01130  Biosynthesis of antibiotics
sfo01230  Biosynthesis of amino acids
Module
sfo_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Z042_12310
   00270 Cysteine and methionine metabolism
    Z042_12310
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Z042_12310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfo04147]
    Z042_12310
Enzymes [BR:sfo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     Z042_12310
Exosome [BR:sfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Z042_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AHG20332
UniProt: W0LDG4
LinkDB All DBs
Position
complement(852362..853504)
Genome map
AA seq 380 aa AA seqDB search
MATLVIHAGDQVDRGNNAIFPPITTASSFIQPNLGEEGEFCYSRCSNPTRYAYETALAEL
EGGVYATATASGMAATALILELLPKDAHVLVMKGVYGGTYRLFERLRKQTSGTTFSYVDL
NDLAAVESHIQENTRLIWIETPTNPLLELVDIKAVCQIAKDKGIISCVDNTFASAWNQRP
LTLGADIVMLSTSKYIGGHSDLIGGAVITNVQDIAKQLDFCKTTVGAIASPFDAYLALRG
MKTLDVRMERQCSNALKIARFLEQHPKVLDVYYPGLESHPQYQLCKKQMRSGGAVVSIRL
KGEITEVKTFIAKLNYFVLAESLGGVESMINHSASMSHGSMSKEEKENIGIYDTTLRLSI
GIEDINDLISDVEQALSFIQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
attgcgacgctggtgatccatgccggggatcaggttgatcgtggtaataatgctattttt
ccgcctattaccactgccagttccttcattcagccgaatttaggtgaagaaggggagttt
tgttattcccgctgtagcaacccgacaagatatgcctatgaaacggcgttggctgagcta
gaaggtggggtctatgctacggcaacggcttctggtatggcagccacggcactcatattg
gaattgctgccgaaagacgcccatgtattagtgatgaaaggggtttatggcgggacttat
cgcttgtttgaacggctgcgtaaacaaacatcgggtaccacattcagctatgtcgatctg
aacgatcttgcagcagtagaaagccatattcaggagaatacgcgtttaatctggattgaa
acgcccactaacccacttttggaattggttgatattaaggcggtgtgccagattgcgaaa
gacaagggcattatcagctgcgtagataacacctttgccagcgcctggaaccaacggcct
ctcaccttaggtgctgatatcgttatgttatctaccagtaaatatattggtgggcattct
gatctgattggtggtgcagtgattaccaatgtgcaggatattgcaaagcaactggatttc
tgtaaaaccacggtgggggctatagcgtctccgtttgacgcttatttggcattacgtggt
atgaaaacactggatgtccgtatggagcgccaatgcagtaacgctttaaaaattgcgcga
tttttagagcagcatcctaaggtacttgatgtttattacccagggctggaatctcatcct
caatatcagttgtgtaaaaaacaaatgcgttctggtggtgcggtagtcagtatccggttg
aaaggtgagataacggaagttaaaacctttattgctaagttaaattattttgttttagcc
gaatcactagggggcgttgaaagtatgattaaccattctgcatcaatgtctcatggttca
atgtccaaggaagagaaggaaaatataggcatatacgatacaacactacgcctttcaata
ggcatcgaggatattaatgatttaatatcagatgtagaacaagccctttcctttatacaa
tga

DBGET integrated database retrieval system