KEGG   Chania multitudinisentens: Z042_20900Help
Entry
Z042_20900        CDS       T02987                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sfo  Chania multitudinisentens
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Z042_20900
Enzymes [BR:sfo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Z042_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHG21795
UniProt: W0LIG7
LinkDB All DBs
Position
4485950..4486657
Genome map
AA seq 235 aa AA seqDB search
MFDPTQFPITQRWPAAHPERLQLYSLPTPNGVKVSIMLEEIGLPYETHLVDISKNETWTP
EFLSLNPNGKIPAILDPHGPGGKPLALFESGAILLYLAEKSGQFLPQDAALRYETIQWVF
FQMAAVGPMFGQLGFFHKFAGREYEDKRPLERYQKESKRLLGVLENRLAGRDWIMGTDYT
IADISLLGWVRNLIGFYEARELIEFDSFPLVGQWLERGLARPAVQRGVNIPARPV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatccaacccaattccccatcacccaacgctggcccgccgcacacccagagcgc
ttacaactttactcgttgccaacgccaaacggagtgaaagtttccatcatgctggaagag
atcggtctgccctatgaaacccatcttgtcgatatcagcaaaaatgaaacctggacgccg
gaattcctgtcactgaaccccaacggtaagatcccggcaatcctcgatccgcacggccct
gggggaaaacctttagcattgttcgagtccggcgcaatcctgctctatctggcggagaaa
agcggtcagttcctgccgcaggatgccgctctgcgttatgaaactatccaatgggtattt
tttcagatggcggccgtcggcccgatgtttggtcaactgggctttttccacaaattcgcc
gggcgtgagtatgaagataaacggccactggaacgctatcagaaagagtctaaacggctg
cttggcgtgctggaaaaccggttggcagggcgcgattggatcatgggaaccgattacact
attgccgatatttcgttgctcggttgggtgcgcaacctgattggtttctatgaagcccgt
gagttgatagagttcgacagcttcccgttggtcggccagtggctggaacgcggattagcc
cggccagccgtgcaacgcggggtgaacattcctgctcgcccagtataa

DBGET integrated database retrieval system