KEGG   Chania multitudinisentens: Z042_20975Help
Entry
Z042_20975        CDS       T02987                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00040  Pentose and glucuronate interconversions
sfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Z042_20975
Enzymes [BR:sfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Z042_20975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N Shikimate_DH Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHG21809
UniProt: W0LHD2
LinkDB All DBs
Position
4468193..4469227
Genome map
AA seq 344 aa AA seqDB search
MKALVLEEKGKIAIQDCQFDETLGDDDVHIKIHSVGICGSDVHYYQHGRIGPFVVNAPMV
LGHESAGVVLAVGKNVRHLQPGDRVCMEPGIPDPQSPQSRAGLYNLDPAVRFWATPPIHG
CLRESVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMHAATKASIKPGDIALVIGAGPIGVV
TALAALAGGCSEVIICDLFDEKLAVAANYDGLHAVNLKTGNLAQKVAELTSGNGVDIVFE
CSGAKAAIATLTEHAAPGATAVLVGMPIDAAPLDIVASQAKEITFKTIFRYANMYPRTLR
LLSSGKLRVQPLISQTYKFADSVAAFERAAAGHAADIKIMLEME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattggttctagaagagaaaggcaaaatcgccattcaggattgtcagtttgat
gaaacgcttggcgatgacgatgtacatatcaagattcattctgtcggtatctgcggcagt
gatgtgcactactatcagcatggccggatcgggcctttcgtggtcaatgcgccaatggtg
ctcggccatgaatccgctggcgtcgtgctggctgtcggaaaaaatgtccgccatctgcaa
cctggcgatcgtgtgtgtatggagccaggcatccccgatcctcagtcacctcaatcccgc
gcaggtctttacaacctggacccggccgtccgcttttgggctaccccaccgatccacggt
tgtttgcgggaaagcgttattcacccggcggcctttaccttcaagctgcctgacaacgtc
agctttgccgaaggtgccatggttgaaccactggcgattggtatgcatgccgcgactaaa
gcctcgatcaaaccgggtgatatcgcgctggtcatcggtgcaggcccaatcggcgtggtt
accgctctggcggcgctggctggcggctgttccgaagtgatcatttgcgatctgtttgat
gagaagctggcagtcgcggcgaattatgatggcctgcacgcggtcaaccttaaaaccggc
aacctggcgcaaaaggtcgccgagttaaccagcggcaacggcgtcgatatcgtttttgaa
tgcagtggtgcaaaagccgccatcgccacgctgaccgaacacgccgcacctggcgcaacc
gcagtgctggtcggtatgccgatcgacgccgcgccgctggatatcgttgcctcgcaggcg
aaagagatcaccttcaagaccattttccgctacgccaatatgtatccgcgcacgctgcgc
ctgctcagcagcggcaagctgcgcgttcagccactgattagccaaacctacaaatttgcc
gacagcgtggccgccttcgagcgcgccgccgccgggcacgctgctgatatcaaaattatg
ctggagatggagtag

DBGET integrated database retrieval system