KEGG   Chania multitudinisentens: Z042_24430Help
Entry
Z042_24430        CDS       T02987                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Z042_24430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfo02000]
    Z042_24430
Enzymes [BR:sfo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Z042_24430
Transporters [BR:sfo02000]
 Other Transporters
  Pores ion channels [TC:1]
   Z042_24430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHG22400
UniProt: W0LKB4
LinkDB All DBs
Position
3767387..3767989
Genome map
AA seq 200 aa AA seqDB search
MKLFYKAGACSLSPHIILREAGLDFTAEKVDLAQKKTESGADYLAINPKGQVPALVLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYVSTEIHKGFSPLFNPKTPDE
YKVIVREKLESQFSYLDSVLAKQHYLLGNRFSVADAYLFTVLRWALAMQFDLKKHAHLTA
YFDRVAARPAVEATLRAEAQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaagccggtgcctgttccctatcaccacacatcattctacgtgag
gcaggattagattttactgcggaaaaagtcgatttggcccagaagaaaacggaaagtggt
gccgactatctggcaatcaatccgaaggggcaagtcccggctctggtacttgacgatggc
agcctgctgaccgagggcgtcgcgattgtgcaatatctcgccgatcgcgtcccggatcgt
aatctgatcccggcagcgggaacactttcacgctatcacgccattgaatggctgaactat
gtctcaacggaaatacataaaggcttcagcccgctgtttaacccaaaaacaccggatgaa
tataaagtcatcgtgcgggaaaaactggagagccagttcagctatctggattcggtgttg
gcaaaacagcattacctgctaggcaaccgtttcagcgtggcggatgcttatctgttcacc
gtgctgcgctgggcgttggctatgcagttcgatctcaaaaagcacgcgcatttaaccgcc
tatttcgaccgcgtcgcggctcgcccggcggtagaagctacgttgcgcgcagaagcacag
taa

DBGET integrated database retrieval system