KEGG   Chania multitudinisentens: Z042_25155
Entry
Z042_25155        CDS       T02987                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
sfo  Chania multitudinisentens
Pathway
sfo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z042_25155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfo01001]
    Z042_25155
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sfo02022]
    Z042_25155
Enzymes [BR:sfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Z042_25155
Protein kinases [BR:sfo01001]
 Histidine kinases
  OmpR family
   Z042_25155
Two-component system [BR:sfo02022]
 OmpR family
  RstB-RstA
   Z042_25155
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-ProteinID: AHG22528
UniProt: W0LF81
LinkDB
Position
complement(3610241..3611545)
AA seq 434 aa
MRKLFIQFFLLLFVCFLVMAMLVGLVYKFTAERAGRQSMDDLMKSSLYLMRSELREIPFK
DWNKTIATLDLNLSFKLHIEPLGKQNLSAELTQRLHQGEIIALDDRYTFMQRIPRSHYVL
VVGPIPYLFYLHQMRILDLVLLIFIGLSLALPVFLWMRPHWRDLLKLENAAQRLGAGHLD
ERTHFEPTSSLNRLSVAFNQMADNINTLIASKKQLIDGIAHELRTPLVRLRYRLAMSDNL
SESEQQALTRDISQLEALIDELLTYARLDRPQVALNIEPIDLPGWLRDKVADMQLIHSDR
QIELNIPHTGDFGGVDLRLMERVLDNLVNNALRYSKQRLRVGLWFDGENACLQVEDDGPG
IPPDARERVFEPFVRLDPSRDRATGGCGLGLAIVHSIALAYQGHVYVEASSLGGAGFRFC
WPLKPTFDLKAEPV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagaaaactttttattcaattcttcctgctgctatttgtctgttttctggtgatggcg
atgctggttggtctggtatacaaattcaccgctgaacgggcgggccgccagtcaatggat
gacctgatgaaaagctcgctgtatctgatgcgcagtgaactgcgggaaattccgtttaag
gattggaataaaaccatcgctacgttggatttaaacctgtcgttcaagctacacatcgag
ccactcggcaaacagaatctgagcgctgaacttacccaacgtttgcaccagggggaaatc
attgccctggacgatcgatatacctttatgcaacgtatcccgcgcagccattatgtgtta
gttgttggcccgatcccctacctgttctatctgcatcaaatgcgcatactggatttggtg
ttgttgatctttattggcctgtcgctggcgttaccggttttcctgtggatgcgcccacac
tggcgagatttgctgaagctggaaaacgccgcgcaacgcttaggtgctggccatcttgat
gaacgcacccattttgagcccacctccagcctcaaccggctcagcgttgcgttcaaccag
atggccgataacatcaacacgctgattgccagcaaaaaacagctgattgacggtatcgcc
catgagttacgtaccccattggttcgcctgcgttatcgcttggcgatgagcgataacctt
tccgaaagtgaacaacaggcactgacccgcgatatcagccagttagaggcgttgattgac
gaattgttgacctatgcacggctggatcgcccgcaggtagcactaaacatcgaacctatt
gatttacccggttggctacgggacaaagtggccgacatgcagttaattcactccgatcgg
cagattgagctcaatattccacatactggtgattttggcggtgtcgatttacggctgatg
gagcgagtgctggataatctggtcaacaacgcgttacgttactcgaagcagcgcctgcgc
gtcggcctgtggtttgatggtgaaaatgcctgcctacaggtagaagatgatgggccaggt
attccgccagacgctcgtgaacgggttttcgaaccttttgtgcgccttgatccaagccgc
gatcgtgcgaccggtggttgtggcttggggttggcgattgttcattctatagcacttgcc
taccagggccatgtctatgttgaggccagttcgctgggcggtgccggcttccgtttctgt
tggccgcttaagccaacctttgatttaaaagcagaaccggtttga

DBGET integrated database retrieval system