KEGG   Staphylococcus felis: C7J90_00285Help
Entry
C7J90_00285       CDS       T05459                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sfq  Staphylococcus felis
Pathway
sfq00010  Glycolysis / Gluconeogenesis
sfq00071  Fatty acid degradation
sfq00280  Valine, leucine and isoleucine degradation
sfq00310  Lysine degradation
sfq00330  Arginine and proline metabolism
sfq00340  Histidine metabolism
sfq00380  Tryptophan metabolism
sfq00410  beta-Alanine metabolism
sfq00561  Glycerolipid metabolism
sfq00620  Pyruvate metabolism
sfq00625  Chloroalkane and chloroalkene degradation
sfq01100  Metabolic pathways
sfq01110  Biosynthesis of secondary metabolites
sfq01120  Microbial metabolism in diverse environments
sfq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C7J90_00285
   00053 Ascorbate and aldarate metabolism
    C7J90_00285
   00620 Pyruvate metabolism
    C7J90_00285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C7J90_00285
   00561 Glycerolipid metabolism
    C7J90_00285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C7J90_00285
   00310 Lysine degradation
    C7J90_00285
   00330 Arginine and proline metabolism
    C7J90_00285
   00340 Histidine metabolism
    C7J90_00285
   00380 Tryptophan metabolism
    C7J90_00285
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C7J90_00285
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C7J90_00285
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C7J90_00285
Enzymes [BR:sfq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C7J90_00285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AVP35493
UniProt: A0A2K3ZKU7
LinkDB All DBs
Position
complement(48860..50287)
Genome map
AA seq 475 aa AA seqDB search
MREQIKQYINGEWIDSASGETIDVINPATEEVFGRIAKGNEEDVNKAVEAARKVYLEFRH
MPVKERQALLGRIVEEYKNRKEDLIEAMTLELGSPIQKSEDVHYQMGLNHFQAAYDALDD
FQFEERRGDHLIVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEMTPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPDIRMMSFTGSGGTGSKIMEKASKDFK
KVSLELGGKSPYIILDDADIEEAAKAAVGKVVNNTGQVCTAGTRTIIPESMKDTFLEKAK
TTMQEVKVGDPQSKETQMGPIVSEKQFKQVQDYIQKGIDEGAELYYGGLGKPKGLEKGYF
AQPTIFANVHNKMTIAQEEIFGPVMSVITYKDLDEAIEIANDTKYGLAGYVYGKDKDTLT
HVARSIEAGTVEINEAGRAPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYYQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagagcaaatcaagcagtatatcaatggagaatggattgatagtgctagtggcgaa
actatcgatgttatcaatccagcgactgaagaagtatttggtcgtatagctaaaggcaac
gaagaagatgtgaacaaagctgttgaagcagcacgaaaagtctatttagagtttcgtcat
atgcctgttaaagaacgtcaagcacttctaggtcgaatagttgaagaatacaaaaatcgc
aaagaagatttaattgaagcgatgacattagaacttggatcacctatccaaaaatcagaa
gatgtccattatcaaatgggactgaaccattttcaagctgcatatgatgcgctagatgat
tttcaatttgaagaaagacgtggagatcacttaattgtaaaggaagcaataggtgttgca
ggattaattacaccttggaacttcccgacaaatcaaacatctcttaaattagcagctgcc
tttgcagcaggaagcccggttgttttaaagccttctgaaatgacaccatttgcagcgatt
attttagctgaaatttttgataaggtaggtgtgccaaaaggtgtatttaaccttgttaat
ggtgatggtgaaggtgttggaaatccacttagcgaacatccagatatacgtatgatgtcg
tttacaggttcaggtggtacaggttcaaaaattatggaaaaagccagcaaagattttaaa
aaggtttcacttgaacttggtggtaaatcaccatatattattctagatgatgctgatatt
gaagaggcggcaaaagcggcagttggcaaagtggttaataatacggggcaagtctgtaca
gcaggaacgcgaacgattattcctgaatcgatgaaagatacatttttagaaaaagccaaa
actacgatgcaagaagtcaaagtgggtgacccacaaagcaaagaaacacaaatgggaccg
attgtgagtgaaaagcaatttaaacaagttcaagattatatccaaaaaggcattgatgaa
ggtgctgaattatattatggtggtctcggtaagccaaaaggactcgaaaaaggatacttt
gcacaaccgactatttttgcaaatgtccataataaaatgacaattgcacaagaagaaatt
tttggccctgtgatgtctgtcatcacctataaagatcttgatgaagctattgaaattgca
aacgatacaaaatatggactcgctggatatgtatacggtaaggataaagacacattaaca
catgtcgcacgttctattgaagcgggtacggttgaaattaatgaagcaggtcgcgcacct
gatttgccatttggtggttataaacaatctggattaggtagagaatggggcgactatggt
atcgaagaatttttagaagttaaatctatcgctggatactaccaatag

DBGET integrated database retrieval system