KEGG   Staphylococcus felis: C7J90_02655Help
Entry
C7J90_02655       CDS       T05459                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sfq  Staphylococcus felis
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7J90_02655
Enzymes [BR:sfq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7J90_02655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO Thi4 FAD_binding_3 NAD_binding_8 NAD_binding_9 K_oxygenase 4_1_CTD
Motif
Other DBs
NCBI-ProteinID: AVP35906
UniProt: A0A2K3ZHG1
LinkDB All DBs
Position
540354..541877
Genome map
AA seq 507 aa AA seqDB search
MLDQELKKQLSQFLDLMEGDVVFKVSAGSDDHSQKLNDLVNEVAEMSPRITVEKAELKRT
PSFSVNRPGEDTGITFAGVPLGHEFNSFVLALLQVSGRAPKEEQSVIDQIKSINEPLNFE
TFVSLTCQKCPDVVQAINLMSVINPNITHTMIDGAVFKEESEDIMAVPSIFLNGEQFGSG
RMTVTDILSELGQGPDASEFEGKETYDVLVIGGGPASASSAIYAARKGLRTGIVADRIGG
QVNDTADIENYIGVTKTNGPALSSNLEQHINDYNVDVMKGVRAEALRKTDEGTEIVLNNG
ATLQTKSLIIATGARWRQLGVPGEQEFANKGVAYCPHCDGPLFEGKDVAVVGGGNSGVEA
AIDLAGICKHVTLLEFGSEMKADQVLQDRLQSLPNTTVITNAATSEITGDDRVNGISYTD
RTTDEVKHIDLDGVFVQIGLSPNTEWLGDTVQRNKMGEIEIDRLGHTNVPGVFAAGDCSD
QRYKQIIISMGSGATAALSAFDYLIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagaattaaagaaacaactctctcaatttcttgatttgatggaaggtgac
gtagtattcaaagtgagtgctggttctgatgatcattcacagaaactaaatgatcttgta
aacgaagtcgctgaaatgtcacctcgaattacagtagaaaaagctgaattaaagcgcaca
cctagttttagtgtgaacagacctggagaggacactggcattacatttgctggtgtccct
cttggtcatgagttcaattcttttgtacttgcactactacaagtaagtgggcgcgcacca
aaagaagaacaatctgtaatcgaccaaatcaaatcaattaacgaacctttaaatttcgag
acatttgtaagcttgacttgtcaaaaatgtccggatgttgttcaagcaattaacctcatg
agcgtgattaaccctaatattacgcatactatgattgacggtgctgtattcaaagaagaa
tcagaagacattatggcagttccctctatcttcttaaatggcgaacaattcggtagcggt
cgcatgactgtgacagatattctaagtgaacttggccaaggcccagatgcttcagaattt
gaaggcaaagaaacttatgatgtattagtgataggtggcggccctgcaagtgcaagttca
gcaatttatgctgcgcgtaaaggcttacgtacaggtatcgttgctgaccgtattggtggt
caagtgaatgatacagccgatatcgaaaactatatcggtgttaccaagacaaatggcccc
gcattatcaagcaacttagagcaacacatcaatgattacaatgttgatgtaatgaaaggt
gtccgagctgaagcacttcgcaaaacagatgaaggtactgaaattgtccttaataacggc
gcgacacttcaaacaaaatccttaattattgcaacaggagcaagatggagacagcttggt
gtacctggtgagcaagaatttgcaaataaaggtgttgcatactgccctcactgtgacggc
cctctatttgaaggtaaagatgtcgcagtagttggtggcggtaactcaggcgttgaagct
gccattgatcttgcaggtatatgtaaacacgttacattacttgagtttgggtctgagatg
aaggctgatcaagttttacaagatcgtctacaatcattacctaatacaactgtgattacg
aatgcagcaacgtcagaaatcactggtgatgaccgtgttaacggtatctcttacactgat
cgtacaactgacgaagtgaagcatattgatttagatggtgtctttgttcaaattgggcta
tctcctaatacagagtggttaggtgacactgtccaacgtaacaaaatgggcgaaatcgaa
atcgatcgtttaggtcatacaaatgttcccggtgtatttgcagctggtgactgttctgac
caacgttacaaacaaattatcatctcaatgggttcaggtgcgactgctgcattatcagca
tttgactatctgattcgtcattaa

DBGET integrated database retrieval system