KEGG   Staphylococcus felis: C7J90_02760Help
Entry
C7J90_02760       CDS       T05459                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
sfq  Staphylococcus felis
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfq03400]
    C7J90_02760
Enzymes [BR:sfq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     C7J90_02760
DNA repair and recombination proteins [BR:sfq03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    C7J90_02760
 Prokaryotic Type
    C7J90_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX dCache_3
Motif
Other DBs
NCBI-ProteinID: AVP35925
UniProt: A0A2K3ZB82
LinkDB All DBs
Position
558844..559323
Genome map
AA seq 159 aa AA seqDB search
MTNNRPKVQVSCLLQSDEKYLMIRRVKKKAHTLMKLIPAGGHVEIGEPLEEAIVREMREE
TGVTVLNPSIIGVISFISEIDNSHNVCFMFKALEYSGETETREPEKVVPEWINTNDLLIN
NDVPSYYAKFFEKHFENPQKFINCTINFKSNGDIITTFN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactaataatcgacctaaagttcaagtgagttgcttattgcagagtgacgaaaaatat
ttaatgattagaagggtaaaaaagaaagcacacacattaatgaagcttattccggctgga
ggacatgtagaaataggagaaccgttagaggaggcaatcgttagagaaatgagagaagag
actggcgtaactgttctcaatccctctattattggagttatttcttttatttctgaaatt
gataatagtcacaatgtttgttttatgttcaaagctctcgaatatagtggagaaactgaa
actagagaacctgaaaaagtagtaccagaatggataaatactaatgatttattaataaat
aacgatgttccttcatattacgcaaaatttttcgaaaagcattttgagaatcctcaaaaa
tttattaactgtactataaatttcaaatctaatggagatataataacgactttcaactaa

DBGET integrated database retrieval system