KEGG   Staphylococcus felis: C7J90_04150Help
Entry
C7J90_04150       CDS       T05459                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sfq  Staphylococcus felis
Pathway
sfq00010  Glycolysis / Gluconeogenesis
sfq00260  Glycine, serine and threonine metabolism
sfq00680  Methane metabolism
sfq01100  Metabolic pathways
sfq01110  Biosynthesis of secondary metabolites
sfq01120  Microbial metabolism in diverse environments
sfq01130  Biosynthesis of antibiotics
sfq01200  Carbon metabolism
sfq01230  Biosynthesis of amino acids
Module
sfq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sfq_M00002  Glycolysis, core module involving three-carbon compounds
sfq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C7J90_04150 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    C7J90_04150 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C7J90_04150 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfq04131]
    C7J90_04150 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfq04147]
    C7J90_04150 (gpmA)
Enzymes [BR:sfq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     C7J90_04150 (gpmA)
Membrane trafficking [BR:sfq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    C7J90_04150 (gpmA)
Exosome [BR:sfq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   C7J90_04150 (gpmA)
  Exosomal proteins of melanoma cells
   C7J90_04150 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind Birna_RdRp
Motif
Other DBs
NCBI-ProteinID: AVP36178
UniProt: A0A2K3ZAW6
LinkDB All DBs
Position
879177..879863
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAQNLFTGWADVDLSEQGVQEAMRSGQKLKAQGVRIDVAFTSLLKR
SIKTTYHLLNESDQLWIPVHKTWRLNERHYGGLQGLNKKETAEKYGEEQVHIWRRSYDVK
PPDQSESQRQEYLKDRKYELLDRRIMPESESLKDTLERVIPYWNDQLSQYLLDGQTVLVS
AHGNSLRALIKFLEGVPDDEIAQYEIKTGAPLIYELDEALHVLDSYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaatattatgtcgtcacggccaaagtgaatggaatgcacaaaacctcttt
acaggatgggcagacgttgatttatctgaacaaggagtacaagaagcaatgcgttccggc
caaaagctcaaagcacaaggtgttcgcattgatgttgcgtttacctcattacttaaacga
tcaattaaaacgacatatcatttgttaaatgaatcggatcaactgtggattccagttcat
aaaacttggcgtttaaatgaacgtcattacggaggattacaaggtttaaataaaaaagaa
accgccgaaaagtatggagaagaacaagttcatatttggcgtcggtcttatgatgtgaaa
ccacctgatcaaagtgagtcacaacgacaagaatacttgaaggatcgtaaatatgaactg
ttagatcgtcgtatcatgccagaaagcgaaagtctaaaagacacgttagagcgagtgatt
ccttattggaatgaccagctttcacaatacttattggacggtcaaactgtattagtctct
gcgcacggaaactcattacgcgcattgattaagtttttagaaggcgtacctgatgacgaa
attgcacaatatgagattaaaacgggagcaccccttatttatgaactagatgaggcactg
catgtcctagatagttactatttataa

DBGET integrated database retrieval system