KEGG   Staphylococcus felis: C7J90_07530Help
Entry
C7J90_07530       CDS       T05459                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sfq  Staphylococcus felis
Pathway
sfq00020  Citrate cycle (TCA cycle)
sfq00190  Oxidative phosphorylation
sfq00650  Butanoate metabolism
sfq01100  Metabolic pathways
sfq01110  Biosynthesis of secondary metabolites
sfq01120  Microbial metabolism in diverse environments
sfq01130  Biosynthesis of antibiotics
sfq01200  Carbon metabolism
Module
sfq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C7J90_07530
   00650 Butanoate metabolism
    C7J90_07530
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C7J90_07530
Enzymes [BR:sfq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C7J90_07530
    1.3.5.4  fumarate reductase (quinol)
     C7J90_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4_15 Fer4 Fer4_18 Fer4_13 Fer4_21 Fer4_3 Fer4_4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AVP36810
UniProt: A0A2K3Z8X8
LinkDB All DBs
Position
1614853..1615668
Genome map
AA seq 271 aa AA seqDB search
MTETQDKQVAVNHGQDQNQNKTIKIIVKRQKDPKSTPYEETFVIPYRENMNVIAALMEIR
RNPVTESGEKTTPVTWDMNCLEEVCGACSMVINGRARQSCSAIIDQLEQPIRLEPMNTFP
VVRDLQVDRTRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTTNNDFVGAQAISQVRLFNLHPTGSMTKDERLDALMLHGGLQACGNSQNCVQACPK
GIPLTTSIAALNRETSFHMFKSFFGSDHKVQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactcaagacaaacaagtagcagtaaatcatggacaagaccaaaaccaaaat
aaaacaattaaaattattgttaaacgacaaaaagatcccaagtcaacaccttatgaagaa
acatttgtgattccttatcgtgaaaatatgaatgttattgcagcgttaatggaaattcgt
cgtaatccagttactgagagcggtgaaaaaacaacaccagtaacatgggatatgaactgt
ttagaggaagtgtgtggagcttgttcgatggtaatcaacggtcgtgcacgtcaatcatgt
tctgcaattatcgatcaacttgaacaacctatccgtttagaaccaatgaacacattccct
gtcgtacgtgatttacaagtcgatcgtacacgtatgttcgacaatctcaaacgtatgaaa
gcgtgggtgccaattgatggaacttatgatttaggtccaggaccacgtatgcccgagaaa
aaacgtcaaacggcatatgaactttcaaaatgtatgacttgtggtgtttgtttggaagtg
tgtcctaacgtaacgactaacaatgattttgtgggtgcacaagccatttctcaagttcgt
ttgtttaacctacacccaacaggctcaatgacaaaggatgaacgtttagatgcgttaatg
ttacatggaggattgcaagcatgcggaaactcacaaaactgtgtacaagcttgtccaaaa
ggaattccattaacaacatctattgcagcattaaatagagaaacatcgttccatatgttt
aaatcattcttcggttcagaccataaagtacaataa

DBGET integrated database retrieval system