KEGG   Staphylococcus felis: C7J90_09315Help
Entry
C7J90_09315       CDS       T05459                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sfq  Staphylococcus felis
Pathway
sfq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C7J90_09315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfq02000]
    C7J90_09315
Enzymes [BR:sfq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     C7J90_09315
Transporters [BR:sfq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    C7J90_09315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_23 RsgA_GTPase AAA_22 AAA_15 AAA_30 AAA_24 ATP_bind_1 AAA_18 Rad17 DUF87 AAA_33 AAA_16 AAA_10 G-alpha RNA_helicase AAA_PrkA PRK FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: AVP37147
UniProt: A0A2K3ZBZ8
LinkDB All DBs
Position
complement(1989881..1990741)
Genome map
AA seq 286 aa AA seqDB search
MINTKTVNENKNENVNTPFTTTQQHEKKDVLTDDERRIVYSTQNLDLWYGEQHSLKNVNL
DILEKNVTAIIGPSGSGKSTYVKTLNRMVELVPGVKTSGKILYRDQNIFDKKYPVEKLRT
NVGMVFQQPNPFPKSIYDNITYGPKIHGIKDKKILDEIVEKSLRGAAIWDELKDRLNQNA
YGLSGGQQQRVCIARCLAIEPDVILMDEPTSALDPISTLRVEELVQDLKKDYSIIIVTHN
MQQAARVSDKTAFFLNGYVNEYDDTDKIFSNPSDKQTEDYISGRFG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgattaatactaaaactgtaaatgaaaataaaaacgaaaatgtaaacacaccatttacg
actactcaacagcatgaaaaaaaagatgtacttaccgatgatgaaagacgtattgtatat
tcaacacaaaatcttgacctttggtatggcgagcaacattctttgaaaaacgtcaactta
gatattttagaaaaaaatgttactgccataattggaccatctggatcaggtaaatcaact
tatgttaaaactttaaatagaatggttgagctagtacctggagtgaaaacatctggaaaa
attttataccgtgatcaaaatattttcgataagaaatatccagttgaaaaattgcgtact
aatgtgggtatggtgtttcaacaacctaatccatttccaaagtcgatttatgacaatatc
acatatggacctaaaattcatggtattaaagataaaaaaatattagatgaaattgttgaa
aagtctttaagaggcgctgcaatttgggatgaattaaaagatcgtttaaaccaaaatgca
tatggattatcaggtggtcaacagcagcgtgtttgcatagcgcgttgtttagctattgaa
ccagacgttatcttaatggatgaaccaacatctgctctagatcctatttctacattaaga
gttgaagaacttgttcaagacttgaagaaagattattctatcatcatcgttacgcacaat
atgcaacaagcagcgcgtgtttctgataaaactgcatttttcttaaatggctatgttaat
gaatatgatgatactgataaaatattttcgaatccgagcgataaacaaactgaagattat
atttcaggacgatttggttaa

DBGET integrated database retrieval system