KEGG   Shewanella frigidimarina: Sfri_0012Help
Entry
Sfri_0012         CDS       T00395                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00071  Fatty acid degradation
sfr00280  Valine, leucine and isoleucine degradation
sfr00281  Geraniol degradation
sfr00362  Benzoate degradation
sfr00592  alpha-Linolenic acid metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01212  Fatty acid metabolism
Module
sfr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sfri_0012
   00592 alpha-Linolenic acid metabolism
    Sfri_0012
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfri_0012
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Sfri_0012
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfri_0012
   00642 Ethylbenzene degradation
    Sfri_0012
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Sfri_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABI69875
UniProt: Q08A40
LinkDB All DBs
Position
complement(15577..16740)
Genome map
AA seq 387 aa AA seqDB search
MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALMVRNPQLDPNDIEDVIWGCVQQ
TLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDALHQAARAIMTGQGDTFIIGGVEH
MGHVPMNHGVDFHPGLANRVAKASGMMGLTAEMLGKMHGITREQQDAFAVRSHQRAHAAT
IEGRFAKEIWGIEGHDANGALIKVMTDEVIRPETTLESLAGLRPAFDPVNGTVTAGTSSA
LSDGASAMLVMEESKARALGLTIRARIRSMAVAGCDAAIMGYGPVPATKKALARAGLSVA
DLDLIELNEAFAAQSLPCVKDLGLQDVVDEKINLNGGAIALGHPLGCSGARISTTLINLM
EEKDATLGLATMCIGLGQGIATVFERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagctgttatcgtagactgcattcgcaccccaatgggccgttctaaggctggg
gtatttagaaatgtacgtgcagaaacattgtctgcagaactaatgaaagcactaatggtg
cgcaacccacaattagacccaaacgacattgaagatgttatttggggttgtgtgcaacaa
actctagagcaaggctttaacattgcccgtaatgcatcattgttagctggtattcctaaa
acggctggcgcagtaacggtaaaccgtttatgtggttcgtcaatggacgcccttcatcaa
gcggctcgcgccattatgactggccaaggtgataccttcattattggtggtgttgagcac
atgggtcatgtaccaatgaaccacggtgttgattttcacccaggccttgccaaccgtgta
gctaaagcatctggcatgatgggcttaactgctgaaatgttaggtaaaatgcacggtatc
actcgtgagcaacaagatgcgtttgctgtacgttctcaccaacgtgcccatgctgcaact
atcgaaggtcgctttgctaaagaaatttggggcattgaaggccacgatgccaacggcgca
ctaattaaagtgatgaccgacgaagtcattcgtccagaaacgacactagagtcacttgcg
ggtttacgcccagcattcgacccagttaacggcacggtgactgcaggtacatcatctgca
ttatctgacggtgcttctgcaatgttagtgatggaagaatctaaagcacgtgctttaggc
ttaactatccgagcacgtattcgttcaatggctgttgccggttgtgatgctgcaattatg
ggttatggtccagtacctgccaccaaaaaagcattagcacgcgcgggcttgtcggttgcc
gatttagaccttatcgaattaaacgaagcgtttgctgcacagtcattaccttgtgttaaa
gatcttggcttgcaagatgttgtcgatgaaaagattaacctgaacggtggcgcaattgca
ttgggccacccactaggttgttctggcgcacgtatatcgacaacactgatcaacttgatg
gaagaaaaagatgcaacgcttggtcttgccaccatgtgtatcggtttaggtcaaggtatc
gcaactgtattcgaacgcgtttaa

DBGET integrated database retrieval system