KEGG   Shewanella frigidimarina: Sfri_0523Help
Entry
Sfri_0523         CDS       T00395                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sfri_0523
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sfri_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like Thi4 FAD_oxidored Glutaredoxin DAO NAD_binding_7 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABI70384
UniProt: Q088D1
LinkDB All DBs
Position
593221..594786
Genome map
AA seq 521 aa AA seqDB search
MLDANVKNQLKTYLQNLKRPVELVVSADDSNKGKELTSLAQDIVDSSDLVSVTYQQGKRT
PSMSVINPQAATNITFAGLPMGHEFTSLVLALLHSGGHPIKLDADIIEQIRQLPGEFHFE
TYISLSCQTCPEVIQALNMMAAINPNITNVMIDGALFQQEVSDRNIMSVPSVFLNGEAFS
VGAISVVEVLNKLDKNAAGRQAEQLNQKSVFDMLVVGGGPAGAAAAIYSARKGLNTGIVA
DKFGGQVAETVGIENFISVSKTEGPKLVANLEAHVKDYDVDIMQNQRALSLAKNGLFDVT
LESGATLSSKTIILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAKSMGNITIITQAMTTEVKGDGIRVTS
LIYTDRATGESNTVTLAGIFVQIGLVPNTEWLKGVVDMTPRGEIIVDERGQTSIPGVFAA
GDVTNTPFKQIIIAMGSGATASLGAFDYLIRHSEEEDVKAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatgtaaaaaatcaactgaaaacctatctgcaaaacctcaagcgccca
gttgaacttgtcgtatctgcagatgactcaaacaaaggcaaagaattaaccagcctagcc
caagacattgttgactcatcagacttagtttcagtcacgtatcagcaaggcaagcgcaca
ccaagcatgagtgtgattaacccacaagctgcaaccaacataacctttgctggattgcca
atgggccatgaatttacctcactggtgttggcgttattacacagcggcggacatccgatt
aagttggatgcggatatcattgaacaaatccgtcagctacctggtgaattccattttgaa
acctatatttcgttaagttgccaaacctgtccagaagtgatccaagcactgaatatgatg
gcggcaattaaccccaatattactaacgtgatgattgacggtgcgcttttccaacaggaa
gtcagcgatcgcaatatcatgtcagttccatcagtatttttaaacggcgaagccttctct
gtcggtgccattagcgttgttgaagtactgaataaattagataaaaatgctgcgggcaga
caagccgaacaattaaaccaaaaatcagtttttgatatgttagtggttggcggcggccca
gctggtgcagccgcggcaatttattctgctcgtaaaggcttaaacaccggtattgttgcc
gataaatttggcggacaagtcgccgaaacagtaggtattgagaactttatttcagtgtct
aaaactgaaggtcctaaactagttgctaaccttgaagcccacgttaaagattatgacgtc
gacattatgcaaaaccaacgggcgttgagtttagctaaaaatggcctgtttgatgtgacc
ctagaaagtggcgcaaccctaagcagtaaaacgataatcttggcaacgggtgcacgttgg
agagaaatgaacgtcccaggtgagcaagaataccgtaataaaggtgtagcgtattgtcca
cactgtgacggcccattgtttaaaggtaaacgtgttgcggttatcggtggtggcaactca
ggaattgaagcggctatcgatttagccaatatcgttgaacacgtcaccgtacttgagttt
gacagtaagttacgtgccgatgaagtgctacagcgcaaagctaaatcaatgggtaacatc
acgattattacccaagcgatgaccacagaagtaaaaggtgatggtatccgcgtaaccagt
ttgatctacaccgatcgtgcaacaggtgaaagcaataccgttaccttagccggtatcttt
gtgcaaattggtttagtgcccaatactgaatggttaaaaggtgtggttgatatgacacct
cgtggcgagattattgtcgatgagcgtggtcaaacctcaattccaggggtattcgccgca
ggtgatgtaaccaataccccgtttaagcaaattattatcgctatgggtagcggcgcaaca
gcatcactgggtgcatttgattatctgatcagacattcagaagaagaggatgtaaaagct
gcatag

DBGET integrated database retrieval system