KEGG   Shewanella frigidimarina: Sfri_0628Help
Entry
Sfri_0628         CDS       T00395                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01130  Biosynthesis of antibiotics
sfr01230  Biosynthesis of amino acids
sfr02024  Quorum sensing
Module
sfr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfri_0628
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sfri_0628
Enzymes [BR:sfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Sfri_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABI70488
UniProt: Q087S7
LinkDB All DBs
Position
732034..733089
Genome map
AA seq 351 aa AA seqDB search
MHYQNDDIRIDEIKELLPPIAILERFPATEHASSTVFNARNSIHQILARKDDRLLVVIGP
CSIHDPVAALEYGQRLVKLREQYKNQLEIVMRVYFEKPRTTVGWKGLINDPYMDNSFQLN
DGLRTARKLLVDLNDSGMPTAGEFLDMITPQYVADMMCWGAIGARTTESQVHRELSSGLS
CPVGFKNGTDGTIKVAIDAIGAASAPHHFLSVTKFGHSAIVSTKGNPDCHIILRGGRAPN
YSAEHVSDIAKQLAKSGLTDNIMIDFSHANSSKDYKKQMLVADDVAGQISQGNHAIFGVM
VESHLVEGRQDLIEGSELCYGQSVTDACIGWDDTESLLATLNKSVLDRRQA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcaaaatgacgatattcgtatcgatgaaataaaagaattgctgccacccatt
gcgattctagaacgatttccggcaaccgaacatgcatcatcaactgtttttaatgcgcgt
aacagtattcatcaaattttagcccgtaaagatgatcgcttattagtggtgattggccct
tgctcaattcacgatcctgttgccgccttagagtatggtcaacgcttagttaaattgcgg
gaacagtataaaaatcagcttgaaattgtcatgcgagtgtattttgaaaagccgagaacg
acagtcggttggaaagggttaattaatgatccttatatggataacagttttcaattaaat
gatggtttacggaccgctcgtaaattacttgtcgatttaaatgactcaggaatgccaaca
gcaggtgagtttttagatatgatcacacctcaatatgttgctgacatgatgtgttggggc
gccatcggcgcacgtactaccgaatctcaagtacaccgtgaattatcatcggggctgtct
tgtcctgtaggatttaaaaatggtaccgacggaaccattaaagtggctattgatgccatt
ggagccgcgagtgcgccacatcatttcttgtcggttactaagtttggtcattcggccata
gtgtcaactaaagggaatccagattgccatatcattttacgtggcggtcgagcacctaac
tatagtgccgaacatgtgtctgatatcgccaaacagcttgctaagtcaggcttaactgac
aatattatgattgattttagccatgctaatagtagtaaagattataaaaagcagatgctg
gttgccgatgatgtcgctgggcaaatatctcaaggtaatcatgctatttttggtgtgatg
gttgaaagtcatttagttgaaggacgccaagacctcattgaaggtagtgaattgtgctac
ggacagagcgtaacggatgcttgtattggttgggatgacacagagtcacttttagcaaca
ctgaataagagtgtacttgaccgacgtcaagcctga

DBGET integrated database retrieval system