KEGG   Shewanella frigidimarina: Sfri_0647Help
Entry
Sfri_0647         CDS       T00395                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00030  Pentose phosphate pathway
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
sfr01230  Biosynthesis of amino acids
Module
sfr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sfr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sfri_0647
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Sfri_0647
Enzymes [BR:sfr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Sfri_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C Mur_ligase_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ABI70507
UniProt: Q087Q8
LinkDB All DBs
Position
749965..752007
Genome map
AA seq 680 aa AA seqDB search
MASQLPVRPYKQAGESMSSRKVLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDF
LKHNPTNPNWVDRDRFVLSNGHGSMLIYSLLHLSGYELPIEELKQFRQLHSKTPGHPEYG
YTPGVETTTGPLGAGISNAVGMAIAEKTLAAQFNRPGHDIVDHFTYCFLGDGCLMEGISH
EVSSLAGTLGLGKLVAFWDDNGISIDGHVEGWFTDDTPKRFEAYGWHVVADVDGHNPDAI
RAAIEEAKSVTDKPSMICCKTIIGFGSPNKSGSHDCHGAPLGDAEIAAAREFLNWPHAPF
EIPSDVYAGWDAKHKGVANESLWNDKFSAYQAAFPELAAEYERRVLKGDLPADFEAKAQT
FIQESQDKAEGIASRKASQNAIGFFGAMLPELLGGSADLAGSNLTLWSGSKGIQDDPAGN
YIYYGVREFGMSGIMNGASLHGGFINYGATFMMFMEYARNAVRMSALMGIQNIFVYTHDS
IGQGEDGPTHQPVEQLANLRLTPNMAVWRPCDAAETAVSWKAAIERRDAPTSLIFSRQGL
KAQARTAEQLANVAKGGYVLSDCQGTADVILIATGSEVQLAMDSAVELTKLGQKVRVVSM
PSTTEFDKQDAAYKESVLPKGVTKRVAVEAAHADFWYKYIGFDGAVVGMTTFGESAPGGD
LLKHFGFTVDNVVKTVQSLG
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaattgcccgttagaccttacaaacaagcaggagagagcatgtcatctcgt
aaagtactcgctaacgctattcgcgccctaagtatggatgcggttcaaaaagccaattct
ggtcatccaggtgccccaatggggatggctgatatcgccgaagtgctatggaatgatttt
ctaaagcacaatccaactaatcctaactgggtcgatcgcgatcgttttgttctgtcaaac
ggtcatggctctatgcttatctactctttactgcatttatctggttatgaattgcctatc
gaagagctaaagcaattccgtcagttgcattctaaaacacctggtcatcctgaatatggt
tatacccctggtgttgaaaccacaacgggtcctttaggtgctggtatcagtaacgcagtt
ggtatggcgattgctgaaaaaaccttagcggctcagtttaaccgtcctggacacgacatt
gtggatcacttcacatactgtttcttaggcgatggttgtttaatggaagggatttctcac
gaagtcagttcattagctggaacattaggccttggtaagttagtggcattttgggatgac
aacggtatttctatcgatggtcatgttgaaggttggttcactgacgatactcctaagcgt
tttgaagcctatggctggcatgttgttgctgatgtagatggtcataatccagatgctatc
cgtgcagcaattgaagaagctaaatctgtaacagataagccatcaatgatttgctgtaaa
accattattggttttggttcgcctaacaaatcgggtagccatgattgtcatggtgcacca
ttaggtgatgctgaaattgcagcagctcgtgagttcttaaactggccacacgctcctttt
gaaatcccatctgatgtgtatgctggttgggatgcaaaacataaaggtgttgctaacgag
tcattatggaatgacaagttttcggcttaccaagcagcgttcccagaacttgctgcagaa
tatgaacgtcgcgtattaaaaggtgatttaccagctgattttgaagctaaagcacaaacc
tttattcaagaaagccaagataaagccgaaggtattgcgagccgtaaagcgtctcaaaat
gccattggtttctttggtgctatgttgcctgaattacttggtggtagcgcagacttagcc
ggctctaacttaacgctttggtctggttcaaaaggtattcaagacgatcctgccggtaac
tacatctattacggtgttcgtgaattcggtatgagcggtattatgaacggcgcgtcgtta
catggtggttttattaactatggcgcaaccttcatgatgttcatggagtacgcacgtaac
gcggtacgtatgtcagcattaatgggcattcaaaacattttcgtttatacccatgactct
attggtcaaggcgaagatggccctactcatcagccggttgagcaattagctaacttacgt
ttaacgcctaatatggcagtatggcgtccatgtgatgcagcggaaactgctgtatcttgg
aaagcggccattgaacgtcgtgatgcacctacatcattaatctttagtcgtcagggtctt
aaagcccaagcgcgtaccgctgagcaattagctaacgtagctaaaggtggttatgtactg
tctgattgccaaggcactgctgatgtgattttgattgcaacaggttcagaagtgcaatta
gctatggattctgcagtagagctaaccaaactaggtcaaaaagtacgggtagtgtctatg
ccttctactaccgagtttgataagcaagatgcagcatataaagaatcggtactaccaaaa
ggagtcactaaacgtgttgctgttgaagcggcacacgctgacttctggtacaaatatatt
ggttttgatggtgctgtagtgggtatgaccacctttggtgagtctgctcctggtggtgat
ttacttaaacatttcggcttcactgttgataatgtagtaaaaactgtccaatctttagga
taa

DBGET integrated database retrieval system