KEGG   Shewanella frigidimarina: Sfri_1747Help
Entry
Sfri_1747         CDS       T00395                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfr  Shewanella frigidimarina
Brite
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sfri_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABI71597
UniProt: Q083G8
LinkDB All DBs
Position
complement(2055788..2056372)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEFHYGKHHNTYVVKLNGLVEGTEFAGKTLEEVVKTS
TGGMFNNAAQVWNHTFYWNCLAPNAGGEATGDIAAAINASFGSFEEFKAKFTDSAVNNFG
SAWTWLVKKADGSLAIVNTSNAATPLTDESVTILLTVDVWEHAYYVDYRNARPEYLAHFW
QLVNWEFVNKNFAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactaccagcattaccttatgcaaagaacgcacttgaaccacacatttct
caagaaaccattgagttccattatggtaagcatcacaacacatatgtggtaaaactaaac
ggtttagttgaaggaactgagtttgctggcaaaacactagaagaagttgttaaaacttca
actggcggtatgttcaacaacgcggctcaagtttggaaccatactttttactggaactgc
ttagcacctaatgctggcggcgaagcaactggcgatatcgctgctgctatcaatgcttca
tttggttcttttgaagaattcaaagctaaatttactgattctgcagtaaataactttggt
agcgcttggacatggttagtgaaaaaagctgatggttcattagctattgttaacactagc
aatgctgctacaccgttaacagatgagtctgttacgattctattaactgtagacgtatgg
gaacatgcttactacgttgattaccgtaacgcacgtccagagtatttagctcacttctgg
cagcttgttaactgggaatttgttaacaagaactttgctgcttaa

DBGET integrated database retrieval system