KEGG   Shewanella frigidimarina: Sfri_1775Help
Entry
Sfri_1775         CDS       T00395                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00500  Starch and sucrose metabolism
sfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfri_1775
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sfri_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ABI71625
UniProt: Q083E0
LinkDB All DBs
Position
complement(2082950..2085412)
Genome map
AA seq 820 aa AA seqDB search
MLKPHLLTHRSIIAKAVTTSMMALALSACSPADTQVNTQAQVVNVAPGTPGTEPTWAFSG
KTGIGTSYEPYVNGNYQDTAANPVSKVWFSIAQGVLTETMFGLIHNAQLKELQFIISGKG
FVDTEKSNTISTIEYLDTDDMGRPLSLAYKVINKDVEGKYQIEKHIFTDPDRNSLMMKVT
FTAFEAGITPHLYVNPHIDNSGANDIASVEGQSLVAYTSDTNSTVMTVKTDVDFVAASAG
FVGTSDGIVDLQDNGKLDYHYQTTSDTNQGGNVALTAQYPTLANVNDSLSFNLVIGFGKD
KASSLATTQATLDAGYDAVKQAYLGDDKHLGWKDYLASLKPLNDMSSNTTDNGKLLYASA
LVLKAQEDKTHAGALIASLSNPWGDTVSAKVGSTGYKAVWPRDFYQCAMAFLAMGDTQTP
KVAFEYLKQVQVQQQTPGFAGTPGWFLQKTHVDGEIEWVGVQLDQTAMPIMLGWKLWQAG
VLNNTEITQWYNDMLKPAANFLVKGGNVKLDWNDTKITPPSTQQERWEEQAGFSPSTTAA
VIAGLVAASDIGALAKDEQAPEYADLARKLQRQLETTMATTTGLLGQTDSKGKVAPYYVR
ISPNGNPNNTDKLIDNNGKPGLDQRLILDGGFLELVRYGVVNAKDPVIKNSVMLIDNQNL
EDNLRVKYQFTAKDGSKVPGYRRYGNDGYGEDTVTGLSYAEKGDTENQRGRVWPFFTGER
GHYELALAKANDTLTPDTKKVLINTYVQGMETFANQGLMLPEQAWDGVGNATRYNYKMGQ
GTNTATPLAWTHAEYVKLVRSMTDEKVWDFYPVVQQTLAK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaccacatttactcacgcatcgcagtatcatagcgaaagctgttacgaccagc
atgatggctctagccttaagtgcgtgctcacctgcagatactcaagtaaacacacaagct
caagttgttaacgtcgcacccggtacgccaggcacagaaccaacttgggcgttctcagga
aaaactggcataggcacatcttacgagccctatgttaacggcaattatcaagacacagct
gcaaacccggtcagtaaagtatggttttcgattgctcaaggcgtattaaccgaaaccatg
tttggccttattcacaatgcccagcttaaagaactgcaatttattatctctggcaaaggc
tttgtcgatactgaaaaaagcaatactatcagcactattgagtatttagataccgatgat
atgggacgaccattatcgctggcttataaagtcattaataaagatgttgaaggtaaatac
caaatagaaaaacatatttttacagatcccgatagaaatagcttgatgatgaaagtcacc
tttactgcttttgaggctggcattacgccacacctttatgtcaatccgcacattgataac
agtggtgccaatgacattgctagtgttgaaggccaatcgctagtggcttacacaagtgac
actaattcaacggtaatgactgttaaaacagatgtcgattttgtcgccgctagcgctggg
ttcgtcggcacatctgatggtattgtcgatttacaagataacggtaaacttgattatcat
taccaaaccactagcgacactaatcaaggcggtaacgtcgcgctaacagcacaatacccc
acccttgccaatgttaatgacagcctaagctttaatttggttattggttttggtaaagac
aaagcaagcagcttagccaccactcaagcgacattagatgcgggttatgacgccgttaaa
caagcgtatttaggcgacgataaacatcttggctggaaagattacttagcctcgctgaag
ccattaaatgacatgagcagcaacactacagataacggtaaattactctatgccagcgcc
ttagtgttaaaagctcaagaagataaaacccatgctggtgcgttaatcgcatcactttca
aatccttggggtgacacggtttcagctaaagtaggcagcacaggctataaagcggtatgg
ccacgtgatttttaccaatgtgcaatggcatttttagccatgggcgatactcaaacaccc
aaagtggcttttgaatatttaaagcaggttcaagttcaacaacaaacacctggttttgca
ggtactcctggatggtttttacaaaaaacccatgtcgatggtgaaattgaatgggttggc
gtgcagctcgatcaaactgccatgccaatcatgctcggctggaaactgtggcaagcaggt
gtacttaacaatacagaaataacccaatggtacaacgacatgcttaaaccagccgctaac
tttttagttaaaggcggtaacgtaaaactggattggaatgacactaaaattacgcctcca
agtactcaacaagaacgctgggaagagcaagcaggattctctccatccacaactgcagcc
gtaattgccggtttagtggctgccagtgatattggagcgctagcgaaagatgaacaagca
cctgagtatgctgatttagcacgtaagctacaacgtcagctcgaaacaacgatggccacc
accacaggcttattaggtcaaactgattccaaaggtaaagttgcaccttattatgtgcgc
attagcccaaatggtaaccctaataacaccgataagctcattgataacaatggtaaacct
ggtttagatcagcgcttgatcctcgacggtggatttttagaattagtccgttatggtgtg
gttaacgctaaagaccctgttattaaaaacagcgtcatgctaatagacaaccaaaatctt
gaagataacttacgagttaaataccaatttaccgccaaagatggcagtaaagtaccagga
taccgccgttatggtaatgatggatacggtgaagacacagtcacaggtcttagctacgct
gaaaaaggcgacaccgaaaatcaacgaggccgagtatggcccttctttaccggtgaacgc
ggtcattatgaattagccttagcaaaagcgaacgacacgttaaccccagacactaagaaa
gttttaatcaatacctatgttcaaggcatggaaacctttgctaaccaagggttaatgttg
ccagagcaagcttgggacggcgtaggcaacgcgactcgctataattacaaaatgggccaa
ggtaccaatacagcaacaccgctagcgtggacccatgctgaatacgttaaattggtgcgt
tcgatgaccgatgaaaaagtatgggacttttaccctgttgtacaacaaacactcgctaaa
tag

DBGET integrated database retrieval system