KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_1934Help
Entry
SFyv_1934         CDS       T03315                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00250  Alanine, aspartate and glutamate metabolism
sfs00410  beta-Alanine metabolism
sfs00640  Propanoate metabolism
sfs00650  Butanoate metabolism
sfs01100  Metabolic pathways
sfs01120  Microbial metabolism in diverse environments
Module
sfs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SFyv_1934
   00650 Butanoate metabolism
    SFyv_1934
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFyv_1934
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFyv_1934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfs01007]
    SFyv_1934
Enzymes [BR:sfs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SFyv_1934
Amino acid related enzymes [BR:sfs01007]
 Aminotransferase (transaminase)
  Class III
   SFyv_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIL40337
LinkDB All DBs
Position
1400584..1401849
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINTLAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGECGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggcagaaaacgctacgctgaaggacgtagagggcaac
gaatacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaattgcaacagtttacccacacggcgtatcagattgtg
ccgtacgaaagctacgtcacgctggcggagaaaattaacacccttgccccagtgagcggg
caggctaaaaccgcattcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgacctggcgtgattgcgtttagcggtggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtcgcg
gccattattttcgaaccggtgcagggcgagtgcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system