KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_2128Help
Entry
SFyv_2128         CDS       T03315                                 

Definition
(GenBank) sorbitol dehydrogenase
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AIL40490
LinkDB All DBs
Position
1524785..1525561
Genome map
AA seq 258 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAIGEQPGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPLIW
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggcgcaacggaaattgccgtcgttgat
gtactggaaaaacgtctggcaataggggaacagcctggtgcgacagtggttattaatggc
gcaaaagaggacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcacctttaatctggtaa

DBGET integrated database retrieval system