KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_2468Help
Entry
SFyv_2468         CDS       T03315                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Brite
Enzymes [BR:sfs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SFyv_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIL40760
LinkDB All DBs
Position
1755906..1756487
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcacatttct
gcggaaactatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgattaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggcgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgccggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagcgcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccgctgaccaccgatgcgactccgctgctgaccgttgatgtctgggaa
cacgcttattacatcgactatcgcaatgcacgtcctggctatctggagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system