KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_4189Help
Entry
SFyv_4189         CDS       T03315                                 

Definition
(GenBank) BglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00010  Glycolysis / Gluconeogenesis
sfs00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFyv_4189
   00500 Starch and sucrose metabolism
    SFyv_4189
Enzymes [BR:sfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SFyv_4189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIL42107
LinkDB All DBs
Position
3003216..3004655
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTCGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKFVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLCGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggtggcgccgttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaaggaccgagcatttgtgacgttctg
acctgtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaa
ggtgatgaagctcagccaaacgaagaagggctgaagttttacgactctctgttcgatgaa
ctgctgaaatacaacatcgaaccggtgataaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaattcgttgatttctttgtccgtttc
gcggaagtggtattcgaacgctacaagcataaagtcaaatactggatgaccttcaacgaa
ataaacaaccagcgtaactggcgtgcgccgctgtttggttactgctgctccggcgtggtg
tataccgagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctggcagtgaaagccgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccctactcatgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctatgcggctattacccg
tcctatgtattgaacgagtgggaacgtcgcggatttaatatcaaaatggaagacggcgat
ctcgatgtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctat
gccctttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcagtgacttacgatggtgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system