KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_4979Help
Entry
SFyv_4979         CDS       T03315                                 

Definition
(GenBank) GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00564  Glycerophospholipid metabolism
sfs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SFyv_4979
Enzymes [BR:sfs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SFyv_4979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AIL42698
LinkDB All DBs
Position
3557427..3558932
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYTRT
YGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggctccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
actggtttgcgttttggcgcaaattcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgcgtgcat
acccaaaagcaggcctacattctgcaaaacgaagataaacgcattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggtgatccgaaa
gcagtgaagattgaagagagtgaaatcaattacctgctgaaagtgtataacgcgcacttt
aaaaagcagctaagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaagccattacccgtgattacacccttgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcagaacatgcgctggaaaaactgacgccgtattatcagggtattggcccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgcgacgattacgccgct
cgcctgcgccgccgttacccgttcctgactgaatcgctggcacgtcactacacgcgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggaacggtaagcgatctcggggaa
gatttcggtcatgagttctacgaagcggaactgaaatacctggtggatcacgaatgggtc
cgccgcaccgacgatgccctgtggcgtcgcacaaaacaaggcatgtggctgaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system