KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_5195Help
Entry
SFyv_5195         CDS       T03315                                 

Definition
(GenBank) Glutamate decarboxylase alpha
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00250  Alanine, aspartate and glutamate metabolism
sfs00410  beta-Alanine metabolism
sfs00430  Taurine and hypotaurine metabolism
sfs00650  Butanoate metabolism
sfs01100  Metabolic pathways
sfs01110  Biosynthesis of secondary metabolites
sfs01120  Microbial metabolism in diverse environments
sfs02024  Quorum sensing
Module
sfs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SFyv_5195
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFyv_5195
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFyv_5195
   00430 Taurine and hypotaurine metabolism
    SFyv_5195
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SFyv_5195
Enzymes [BR:sfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SFyv_5195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIL42863
LinkDB All DBs
Position
3716357..3717757
Genome map
AA seq 466 aa AA seqDB search
MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKQ
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaagctgttaacggatttccgctcagaactactcgattcacgttttggcgca
aaggccatttctactatcgcggagtcaaaacgatttccgctgcacgaaatgcgcgatgat
gtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgtcagaaccta
gccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcgatc
aataaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaatatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctagtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgtgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttccca
caaccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgctgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctgggtggtcaaattggtacttttgccatcaacttctcccgcccg
gcgggtcaggtaattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcctcttaccaggttgccgcttatctggcggatgaaatcgccaaacag
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system