KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_5392Help
Entry
SFyv_5392         CDS       T03315                                 

Definition
(GenBank) Phosphate import ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SFyv_5392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfs02000]
    SFyv_5392
Enzymes [BR:sfs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SFyv_5392
Transporters [BR:sfs02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SFyv_5392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_29 RsgA_GTPase AAA_16 AAA_23 Rad17 PRK AAA_30 AAA_33 AAA_24 PhoH G-alpha AAA_25 RNA_helicase Adeno_IVa2 ATPase_2 AAA_18 AAA_5 TniB AAA_28 APS_kinase
Motif
Other DBs
NCBI-ProteinID: AIL43010
LinkDB All DBs
Position
3860314..3861087
Genome map
AA seq 257 aa AA seqDB search
MSMVETAPSKIQVRNLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMF
ELYPEQRAEGEILLDGDNILTNSQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEK
LSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEP
CSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSNTDDLF
TKPAKKQTEDYITGRYG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggttgaaactgccccgagtaaaattcaggttcgtaatttgaacttctactac
ggcaaattccatgccctgaaaaacatcaacctggatatcgccaaaaaccaggttacggcg
tttatcgggccgtccggctgcggtaaatcgacgctgctgcgtaccttcaacaaaatgttt
gaactgtacccggagcagcgtgcggaaggtgaaattctgcttgatggcgacaacatcctg
accaactctcaggatatcgccctgctgcgtgcgaaagtgggcatggtgttccagaaaccg
acgccgttcccgatgtccatctacgacaacatcgcctttggcgttcgtctgtttgagaag
ctctcccgtgccgacatggacgagcgcgtgcagtgggcattgaccaaagccgcattgtgg
aacgaaaccaaagataaattgcaccagagcggttactctctctctggtggtcagcaacag
cgtctgtgtattgcgcgtggtatcgccattcgcccggaagtgctgctgctcgacgaaccg
tgttcggcgctcgaccccatctctaccgggcgtattgaagagctgatcaccgaactgaag
caggattacaccgtggtgatcgtcacccacaacatgcagcaggctgcgcgttgttccgac
cacacggcatttatgtacctgggcgaattgattgagttcagcaacacggacgatctgttc
accaagccagcgaagaaacaaacagaagactacatcaccggtcgttacggttga

DBGET integrated database retrieval system