KEGG   Shigella flexneri NCTC1: NCTC1_00090Help
Entry
NCTC1_00090       CDS       T03751                                 

Gene name
ddl_1
Definition
(GenBank) D-alanine--D-alanine ligase,D-alanine--D-alanine ligase B,D-alanine--D-alanine ligase,Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase),D-alanine--D-alanine ligase,D-ala D-ala ligase C-terminus
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sft  Shigella flexneri NCTC1
Pathway
sft00473  D-Alanine metabolism
sft00550  Peptidoglycan biosynthesis
sft01100  Metabolic pathways
sft01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sft00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC1_00090 (ddl_1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC1_00090 (ddl_1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NCTC1_00090 (ddl_1)
Enzymes [BR:sft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCTC1_00090 (ddl_1)
Peptidoglycan biosynthesis and degradation proteins [BR:sft01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC1_00090 (ddl_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATPgrasp_YheCD TTL ATPgrasp_ST GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: CDX05385
UniProt: Q83MF7
LinkDB All DBs
Position
1:100338..101258
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSIDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQAL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggcgggacttccgctgagcgggaagtttctctg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgatgcgtatcctgtc
gacccgaaagaagtcgacgtgacgcaactgaagtcgatgggttttcagaaagtgtttatc
gcgctacacggtcgcggcggtgaagatggtacgctgcagggcatgctcgagctgatgggc
ttgccttataccggcagcggagtgatggcatctgcgctttcaatagataaactacgcagc
aaacttctgtggcaaggtgccggtttaccggtcgcgccgtgggtagcgttaacccgcgca
gagtttgaaaaaggcctgagcgataagcagttagcagaaatttctgctctgggtttgccg
gttatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggccggagttcacggttgcgatactcggtgaagaaattttaccgtca
atacgtattcaaccgtccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccccgcaggtctggaagcgtcacaagaggccaatttgcaggcatta
gtgctgaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagtgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agcctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system