KEGG   Shigella flexneri NCTC1: NCTC1_00444Help
Entry
NCTC1_00444       CDS       T03751                                 

Gene name
glsA_1
Definition
(GenBank) glutaminase,Glutaminase 1,glutaminase,glutaminase A,Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sft  Shigella flexneri NCTC1
Pathway
sft00220  Arginine biosynthesis
sft00250  Alanine, aspartate and glutamate metabolism
sft00471  D-Glutamine and D-glutamate metabolism
sft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCTC1_00444 (glsA_1)
   00220 Arginine biosynthesis
    NCTC1_00444 (glsA_1)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NCTC1_00444 (glsA_1)
Enzymes [BR:sft01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NCTC1_00444 (glsA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CDX05721
UniProt: A0A2I8JJI5
LinkDB All DBs
Position
1:447011..447943
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENAEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtaccaggtcaactg
gcggcagtggctatcgtgacctgcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcactggaatccatctctaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaacgccgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataatcgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctctacgctcatc
aatactgttgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggcgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaatagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system