KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_00903Help
Entry
NCTC1_00903       CDS       T03751                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase, 6-phosphogluconolactonase,6-phosphogluconolactonase, 3-carboxymuconate cyclase,Lactonase, 7-bladed beta-propeller
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00030  Pentose phosphate pathway
sft01100  Metabolic pathways
sft01110  Biosynthesis of secondary metabolites
sft01120  Microbial metabolism in diverse environments
sft01130  Biosynthesis of antibiotics
sft01200  Carbon metabolism
Module
sft_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sft_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
sft_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCTC1_00903 (pgl)
Enzymes [BR:sft01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     NCTC1_00903 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: CDX06152
UniProt: A0A2S4MUP3
LinkDB All DBs
Position
1:871910..872905
Genome map
AA seq 331 aa AA seqDB search
MKQTVYIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSPDKRYLYVGVRPEFRV
LAYRIAPDDGALTFAAESVLPGSPTHISTDHQGQFVFVGSYNAGNVSVTRLEDGLPVGVV
DVVEGLDGCHSANISPDNRTLWVPALKQDRICLFTVSDDGHLVAQDPAEVTTVEGAGPRH
MVFHPNEQYAYCVNELNSSVDVWELKDPHGNIECVQTLDMMPENFSDTRWAADIHITPDG
RHLYACDRTASLITVFSVSEDGSVLSKEGFQPTETQPRGFNVDYSGKYLIAAGQKSHHIS
VYEIVGEQGLLHEKGRYAVGQGPMWVVVNAH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacagtttatatcgccagccctgagagccagcaaattcacgtctggaacctg
aatcatgaaggcgcactgacgctgacacaggttgtcgatgtgccggggcaggtgcagccg
atggtggtcagcccggacaaacgttatctctatgttggtgttcgccctgagtttcgcgtc
ctggcgtatcgtattgccccggacgatggcgcactgacctttgccgcagagtctgtgctg
ccgggtagtccgacgcatatttccaccgatcaccaggggcagtttgtctttgtaggttct
tacaatgcgggtaacgtgagcgtaacgcgtctggaagatggcctgccagtgggcgtcgtc
gatgtagtcgaggggctggacggttgccattccgccaatatctcaccggacaaccgtacg
ctgtgggttccggcattaaagcaggatcgcatttgcctgtttacggtcagcgatgatggt
catctggtggcgcaggaccctgcggaagtgactaccgttgaaggggccggcccgcgtcat
atggtattccatccaaacgaacaatatgcgtattgcgtcaatgagttaaacagctcagtg
gatgtctgggaactgaaagatccgcacggcaatatcgaatgtgtccagacgctggatatg
atgccggaaaacttctccgacacccgttgggcggctgatattcatatcaccccggatggt
cgccatttatacgcctgcgaccgtaccgccagtctgattaccgttttcagcgtttcggaa
gatggcagcgtgttgagtaaagaaggcttccagccaacggaaacccagccgcgcggcttc
aatgttgattacagcggcaagtatctgattgccgctgggcaaaaatctcaccacatctcg
gtatacgaaattgttggcgagcaggggctactgcatgaaaaaggccgctatgcggtcggg
cagggaccaatgtgggtggtggttaacgcacactaa

DBGET integrated database retrieval system