KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_00985
Entry
NCTC1_00985       CDS       T03751                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase,Ribosomal RNA large subunit methyltransferase L,23S rRNA m(2)G2445 methyltransferase,Predicted O-methyltransferase,conserved hypothetical protein,Putative RNA methylase family UPF0020
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sft00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sft03009]
    NCTC1_00985 (rlmL)
Enzymes [BR:sft01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     NCTC1_00985 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     NCTC1_00985 (rlmL)
Ribosome biogenesis [BR:sft03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NCTC1_00985 (rlmL)
SSDB
Motif
Pfam: UPF0020 THUMP Methyltrans_SAM Cons_hypoth95 Methyltransf_31 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 N6_Mtase Methyltransf_24
Other DBs
NCBI-ProteinID: CDX06233
UniProt: A0A383K150
LinkDB
Position
1:954427..956535
AA seq 702 aa
MNSLFASTARGLEELLKTELENLGAVECQVVQGGVHFKGDTRLVYQSLMWSRLASRIMLP
LGECKVYSDLDLYLGVQAINWTEMFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAF
TRKNLPRPNVDRDAPDIRVNVWLHKETASIALDLSGDGLHLRGYRDRAGIAPIKETLAAA
IVMRSGWQSGTPLLDPMCGSGTLLIEAAMLATDRAPGLHRGRWGFSGWAQHDEAIWQEVK
AEAQTRARKGLAEYSSHFYGSDSDARVIQRARTNARLAGIGELITFEVKDVAQLTNPLPK
GPYGTVLSNPPYGERLDSEPALIALHSLLGRIMKNQFGGWNLSLFSASPDLLSCLQLRAD
KQYKAKNGPLDCVQKNYHVAESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRL
YDADLPEYNVAVDRYADWVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLK
TRERHKGKNQYQKLGEKGEFLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK
DFLNLFSYTGSATVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTRRAHRLIQADCLA
WLREANEQFDLIFIDPPTFSNSKRMEDAFDVQRDHLALMKDLKRLLRAGGTIMFSNNKRG
FRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCWLITAA
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgaattctctgtttgccagtacggcccgtgggctggaagagctgttaaaaactgaactg
gaaaatctgggggccgttgaatgccaggtggttcagggtggggtccatttcaagggcgac
acacggcttgtttaccagagcctgatgtggagccgcctggcctcgcgtattatgttgccg
ctgggcgagtgtaaggtttacagcgatttagacctctatctcggtgttcaggcgatcaac
tggacagagatgtttaatcctggcgcgaccttcgctgtccacttcagtggtttgaatgac
accatccgcaacagtcagtacggcgcgatgaaagtgaaagacgcgatcgtcgatgctttc
acacggaaaaatctgccgcgtccaaatgttgatcgcgatgcgccggatatccgcgttaac
gtctggctgcataaagaaaccgccagtatcgctcttgatctgagtggtgatggtttacat
ctgcgtggctatcgcgatcgtgctggtattgcgccgatcaaagaaaccctggcagccgct
attgtgatgcgatccggctggcagtcaggaacaccgctgctcgatccgatgtgtggttcc
ggtacgttgctgattgaagcggcgatgctggcgaccgatcgcgcaccaggcttgcaccgt
gggcgttggggctttagcggctgggcgcagcatgatgaagctatctggcaggaagtgaaa
gcggaagcgcaaactcgcgcccgtaaaggcctagctgagtatagctctcatttttacggt
tcggacagcgacgcacgggtgattcaacgtgcgcgcactaacgcccgtcttgcggggatt
ggtgaactgatcacctttgaggtgaaagatgtcgcgcaactgaccaatccgctgccgaaa
gggccgtacggtacagtgttgagcaacccgccatacggtgaacgtctggacagcgaaccg
gcgctgattgcgctgcatagtctgctgggccgaatcatgaaaaaccagttcggtggctgg
aatctctctttgtttagtgcctcgccggatctgctaagctgcctgcagctgcgtgcagac
aaacagtacaaggcgaaaaacggcccgctggactgcgtacagaaaaattaccacgttgcc
gaaagcacaccagacagtaaaccggcaatggtagcggaagattacgccaaccgcctgcgt
aagaacctcaaaaaattcgagaagtgggcacgccaggaagggattgaatgttaccgcctg
tatgacgccgatctgccggaatataacgttgccgttgaccgttatgccgactgggtggtg
gtgcaggagtatgcgccgccaaaaactattgatgcgcacaaagcgcgtcagcgtctgttc
gatattatcgctgcaaccatttcggtactggggattgcgccaaacaaactggtgctgaaa
acccgtgaacgccataagggcaaaaaccagtaccagaaactgggcgagaagggcgagttt
cttgaagttaccgaatataacgctcacttgtgggtgaacctgacggattatctcgatact
ggtctgttcctcgatcaccgtatcgcccgccgtatgctcggtcagatgagcaaaggcaaa
gatttcctcaacctgttttcttataccggcagcgccaccgtgcatgcgggattaggcggt
gcacgcagcaccaccaccgtggatatgtcgcgtacttatctggaatgggcagaacgcaac
ctgcgtctgaatggcctgactaggcgtgcgcatcgcctgattcaggccgattgcctggcg
tggctgcgtgaggcaaatgaacagttcgatctgatctttatcgatccgccaaccttctct
aactcaaaacgaatggaagatgcgtttgatgttcagcgcgatcatctggcgctgatgaaa
gatttgaaacgtctgctgcgtgcaggtgggacgatcatgttctcgaacaacaaacgtggc
ttccgtatggatctcgacggcctggcaaaactgggactgaaagcacaagaaattacgcaa
aaaacgctctcccaggatttcgcccgtaaccgccagatccacaactgctggctgattacc
gcagcctga

DBGET integrated database retrieval system