KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_02367
Entry
NCTC1_02367       CDS       T03751                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase,L-threonine 3-dehydrogenase,galactitol-1-phosphate dehydrogenase,L-threonine 3-dehydrogenase,Alcohol dehydrogenase GroES-like domain
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00052  Galactose metabolism
sft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCTC1_02367 (gatD)
Enzymes [BR:sft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     NCTC1_02367 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N PrmA Methyltransf_25 ELFV_dehydrog FAD_binding_2 MTS TrkA_N Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: CDX07541
UniProt: A0A3T3S2B7
LinkDB
Position
1:complement(2143887..2144927)
AA seq 346 aa
MKSVVNDTDGIVRVAKSVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFTQAVRDIARNAMQGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtagtgaatgatactgatggtatcgtgcgcgttgcaaaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggatttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgagccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggctattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggcgatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactattccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcacccaggcggtgcgtgacatcgctcgtaatgccatgcagggc
aaagtgttgctcattccatga

DBGET integrated database retrieval system