KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_02565Help
Entry
NCTC1_02565       CDS       T03751                                 

Gene name
arnB
Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase, UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase,Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis,UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase,DegT/DnrJ/EryC1/StrS aminotransferase family
  KO
K07806  UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00520  Amino sugar and nucleotide sugar metabolism
sft01100  Metabolic pathways
sft01503  Cationic antimicrobial peptide (CAMP) resistance
sft02020  Two-component system
Module
sft_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCTC1_02565 (arnB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC1_02565 (arnB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NCTC1_02565 (arnB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sft01005]
    NCTC1_02565 (arnB)
   01007 Amino acid related enzymes [BR:sft01007]
    NCTC1_02565 (arnB)
Enzymes [BR:sft01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     NCTC1_02565 (arnB)
Lipopolysaccharide biosynthesis proteins [BR:sft01005]
 Unusual sugar
  NCTC1_02565 (arnB)
Amino acid related enzymes [BR:sft01007]
 Aminotransferase (transaminase)
  Others
   NCTC1_02565 (arnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase OKR_DC_1 PaRep2b
Motif
Other DBs
NCBI-ProteinID: CDX07733
UniProt: A0A2Y4FLR4
LinkDB All DBs
Position
1:2341756..2342913
Genome map
AA seq 385 aa AA seqDB search
MAEGKAMSEFLPFSRPAMGVEELAAVKEVLESGWITTGPKNQALEQAFCQLTGNQHAIAV
SSATAGMHITLMALEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAI
ESAITPRTKAIIPVHYAGAPADIDAIRAIGERYGIAVIEDAAHAVGTYYKGRHIGAKGTA
IFSFHAIKNITCAEGGLIVTDNENLARQLRMLKFHGLGVDAYDRQTWGRAPQAEVLTPGY
KYNLTDINAAIALTQLVKLEHLNTRRREIAQQYQQALAALPFQPLSLPAWPHVHAWHLFI
IRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICS
LPLFPDMTTADADRVITALQQLAGQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggaaaagcaatgtcagaatttttgcctttttcgcgaccagcaatgggcgtg
gaggaactcgctgcagttaaagaggttctcgaatccggttggatcacaaccggtccgaag
aatcaggcgcttgagcaagccttttgccagttgacgggaaatcagcatgccatcgcggtc
agttcagccaccgccggaatgcatatcacgctaatggcgttggaaattggcaagggcgat
gaagtgattacgccttccctgacctgggtttcaaccctcaatatgatttccttgctgggt
gcaacgccggtaatggtggatgtcgaccgcgatacgctgatggtcacgcctgaagcgatc
gaatcagccattacgccacgcactaaagccatcattccggtgcattatgccggtgcgcca
gcagatattgacgccattcgcgccattggcgaacgttacggcatcgcagttatcgaagat
gctgcccatgccgtcggtacgtattacaaagggcgacatattggcgcaaaaggtaccgct
attttttcatttcatgccattaaaaatattacctgtgctgaaggtggcctgattgtaact
gataatgaaaaccttgcccgccagctacggatgctgaaatttcacggtctgggtgtcgat
gcctatgacagacaaacctggggccgtgcaccgcaggctgaagtcttaacaccgggctat
aagtacaatctgaccgatattaacgccgcgattgccctgacacagttagtcaaattagag
cacctcaacacccgtcggcgcgaaattgcccagcaatatcagcaagcactggcagctctc
ccctttcagccattaagccttcccgcctggccgcacgttcacgcctggcatctgtttatt
attcgtgtcgatgaacaacgttgtggtatcagtcgcgatgcgttgatggaagcgttaaaa
gaaagaggcattggtaccgggttacatttccgcgccgctcacacacaaaaatattatcgc
gagcgttttcccacgctgtcgttaccgaataccgaatggaatagcgaacgcatctgttcg
ttgccgctgttcccggatatgactaccgccgatgccgaccgcgtcatcacagcccttcag
caactcgcaggacaataa

DBGET integrated database retrieval system