KEGG   Syntrophobacter fumaroxidans: Sfum_1767Help
Entry
Sfum_1767         CDS       T00418                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfu  Syntrophobacter fumaroxidans
Brite
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sfum_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABK17454
UniProt: A0LJ52
LinkDB All DBs
Position
2159942..2160535
Genome map
AA seq 197 aa AA seqDB search
MSLTLPDLPYAKNALEPHISARTLEFHHGKHHKAYVDMGNKLTAGTEFENADPEAVLKKI
VGDASKAGMFNNVAQAWNHAFYWKCMKPNGGGAPTGAVAQKINADFGSFEKFAEEFKNAG
MTQFGSGWAWLVLKNGKLEVTKTPNADTPVAHGVKPLLVVDVWEHAYYLDYQNLRANYLA
TFVEKLINWDFVNSNLG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcacgctacccgatctgccctacgccaagaatgcgctcgaacctcatatcagc
gcccgcactctggaattccatcacggcaagcatcacaaagcctacgtcgacatggggaac
aagctgaccgcgggcacggaattcgagaacgcggatcccgaggcggtcctgaagaagatt
gtgggggatgcttccaaggccgggatgttcaacaacgtggctcaggcctggaaccatgcg
ttctactggaagtgcatgaaaccgaatggaggcggcgcgccgaccggtgccgtcgcgcag
aaaatcaacgccgatttcggcagcttcgaaaaattcgcggaagaattcaagaacgcggga
atgacccaattcggcagcggctgggcgtggctggtcctcaagaacggcaagctcgaagtg
accaagacccccaacgccgatactcccgttgctcatggggtcaagccactgctggtggtc
gatgtctgggagcatgcctattatctggactaccagaacctgagggcgaactacctggcc
accttcgttgagaaactgatcaactgggatttcgtcaattccaacctcggctga

DBGET integrated database retrieval system