KEGG   Syntrophobacter fumaroxidans: Sfum_2463Help
Entry
Sfum_2463         CDS       T00418                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
sfu  Syntrophobacter fumaroxidans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_11 Methyltransf_12 Methyltransf_25 2-Hacid_dh_C DUF4124 PHD_4 GFO_IDH_MocA MTS
Motif
Other DBs
NCBI-ProteinID: ABK18143
UniProt: A0LL41
LinkDB All DBs
Position
complement(3042328..3043344)
Genome map
AA seq 338 aa AA seqDB search
MKVSYWHSNNDIRIEEVATPRPGPKEMLLKVASCGICGSDVVEWYRKPRAPLVQGHEIGA
EVVEVGSSVTGFKVGERVFAVPKVPCMECHYCRNGHYPQCAEIKVRLPGGFAEYILVPEI
LVEKGTYHLPDTITYDQSTFIEPLACVVRAQRLAGIRAGQTVVVLGCGMSGLLHVKLAKA
RDCRVVAADVNRKRLAFAEQLGADLIVDAAGDVSESFAAAGDKKADAVMICTSAVSAVEQ
AWRCVDKGGAIVFFAVPGPGRDIVVPVNDFWTREIRILTSYYCGPPDIDDALKLLESGRI
EVEDMITHRLPLRDIAKGFQLVIDANESIKVIIKPNEI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctcctattggcactccaacaacgatatcagaatcgaggaagtggctaccccc
aggcccggcccgaaggaaatgctcttgaaggtcgcttcgtgcggcatatgcggaagcgac
gtggtcgaatggtaccgcaagcccagggcgccgctggttcagggacatgaaatcggagcc
gaggtggtcgaggtcgggagttccgtaacgggattcaaggtcggcgaaagggtcttcgcg
gttcccaaggttccatgcatggagtgtcattactgcaggaacggtcattaccctcagtgc
gcggaaatcaaagtcaggctgcccggcggctttgcggaatatattcttgtccccgagatt
cttgtggaaaaggggacctatcatctaccggacaccatcacctatgatcaaagcactttc
attgagcctctggcctgtgtggtcagagctcagagacttgccggaatacgagcgggccaa
acggttgtggtgctcgggtgcgggatgtcgggcctgctgcacgtgaaacttgccaaagcc
cgggactgcagggtcgtggcggcggacgtgaaccgcaagagactggcattcgcggaacaa
ctcggcgcggatctcatcgtcgatgccgcgggcgatgtttctgaaagtttcgcggctgca
ggcgacaaaaaggccgacgcggtcatgatatgcacatccgcggtctccgccgtggaacag
gcgtggagatgcgtggataagggaggcgcgatcgtattcttcgccgtcccgggaccgggc
agggacattgttgtgcctgtgaacgatttctggaccagggaaatcagaatcctcacttcc
tactattgtgggcctcccgatattgatgatgcactgaagctccttgagtcaggaagaatc
gaggtggaggatatgatcacgcacagacttcccttgcgtgatattgcgaaagggtttcaa
ttggttatagacgccaacgagtcaatcaaggtaatcatcaagccaaatgaaatttga

DBGET integrated database retrieval system