KEGG   Syntrophobacter fumaroxidans: Sfum_2463
Entry
Sfum_2463         CDS       T00418                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00040  Pentose and glucuronate interconversions
sfu00051  Fructose and mannose metabolism
sfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sfum_2463
   00051 Fructose and mannose metabolism
    Sfum_2463
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Sfum_2463
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_11 Methyltransf_12 Methyltransf_25 2-Hacid_dh_C DUF4124 PHD_4 MTS MetW
Other DBs
NCBI-ProteinID: ABK18143
UniProt: A0LL41
LinkDB
Position
complement(3042328..3043344)
AA seq 338 aa
MKVSYWHSNNDIRIEEVATPRPGPKEMLLKVASCGICGSDVVEWYRKPRAPLVQGHEIGA
EVVEVGSSVTGFKVGERVFAVPKVPCMECHYCRNGHYPQCAEIKVRLPGGFAEYILVPEI
LVEKGTYHLPDTITYDQSTFIEPLACVVRAQRLAGIRAGQTVVVLGCGMSGLLHVKLAKA
RDCRVVAADVNRKRLAFAEQLGADLIVDAAGDVSESFAAAGDKKADAVMICTSAVSAVEQ
AWRCVDKGGAIVFFAVPGPGRDIVVPVNDFWTREIRILTSYYCGPPDIDDALKLLESGRI
EVEDMITHRLPLRDIAKGFQLVIDANESIKVIIKPNEI
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaagtctcctattggcactccaacaacgatatcagaatcgaggaagtggctaccccc
aggcccggcccgaaggaaatgctcttgaaggtcgcttcgtgcggcatatgcggaagcgac
gtggtcgaatggtaccgcaagcccagggcgccgctggttcagggacatgaaatcggagcc
gaggtggtcgaggtcgggagttccgtaacgggattcaaggtcggcgaaagggtcttcgcg
gttcccaaggttccatgcatggagtgtcattactgcaggaacggtcattaccctcagtgc
gcggaaatcaaagtcaggctgcccggcggctttgcggaatatattcttgtccccgagatt
cttgtggaaaaggggacctatcatctaccggacaccatcacctatgatcaaagcactttc
attgagcctctggcctgtgtggtcagagctcagagacttgccggaatacgagcgggccaa
acggttgtggtgctcgggtgcgggatgtcgggcctgctgcacgtgaaacttgccaaagcc
cgggactgcagggtcgtggcggcggacgtgaaccgcaagagactggcattcgcggaacaa
ctcggcgcggatctcatcgtcgatgccgcgggcgatgtttctgaaagtttcgcggctgca
ggcgacaaaaaggccgacgcggtcatgatatgcacatccgcggtctccgccgtggaacag
gcgtggagatgcgtggataagggaggcgcgatcgtattcttcgccgtcccgggaccgggc
agggacattgttgtgcctgtgaacgatttctggaccagggaaatcagaatcctcacttcc
tactattgtgggcctcccgatattgatgatgcactgaagctccttgagtcaggaagaatc
gaggtggaggatatgatcacgcacagacttcccttgcgtgatattgcgaaagggtttcaa
ttggttatagacgccaacgagtcaatcaaggtaatcatcaagccaaatgaaatttga

DBGET integrated database retrieval system