KEGG   Syntrophobacter fumaroxidans: Sfum_3218Help
Entry
Sfum_3218         CDS       T00418                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sfu  Syntrophobacter fumaroxidans
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sfum_3218
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sfum_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin HI0933_like GIDA Pyr_redox GST_N_3 Thi4 FAD_binding_2 FAD_oxidored GST_N_2 K_oxygenase Lycopene_cycl GST_N DAO NAD_binding_8 FAD_binding_3 DUF836
Motif
Other DBs
NCBI-ProteinID: ABK18891
UniProt: A0LN89
LinkDB All DBs
Position
complement(3939315..3940502)
Genome map
AA seq 395 aa AA seqDB search
MAVDVIVYTVEECPFCEKAKRFLAEKGIEYKEIPVRPASRQWLEMKEKTGGGTVPQVLVE
GVPVGGYSDLVSLEATGELYRRLGMKDREAAATLYDVIILGAGPAGLSAAIYAIRKLLKT
LVISRDVGGQVTWTADVENYLGFSHVNAGDLVARFEEHVKTFGVERVIGPEVTSVDLTAK
IKRVVTDDGKVYSGKTLIIATGGRHRHMNIEGEHELIAKGISYCSTCDAPLYDGADVAVI
GGGNSALAAALDLIQIANRIYLVSMTPLTGDPLYQEKVQKSEKVEMFLEYVPVRVLGDKA
VRGVEIRSLQSGEVRELTVEGIFVEIGILPNSSLFVDTLATNRRGEILVDLECRTGLAGV
FACGDVTNVPFKQVVVAVGEGAKAALSAYSYLINQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggatgtgatcgtctatacggtggaggaatgcccgttttgcgagaaggccaag
cggtttctcgccgagaagggtatcgaatacaaggaaatcccagttcgcccggcctccagg
cagtggctcgagatgaaggaaaagaccgggggcggcacagttccccaggtgctcgtcgaa
ggcgtgccggtcggcgggtattccgacctggtgagcctcgaggcgaccggagagctttac
cgcaggctcggaatgaaggacagggaggccgccgcgaccctttacgacgtcatcattctc
ggggcaggtcccgccgggttgagcgccgccatatacgccatccgcaagctgctcaaaacc
ctggtcatcagccgggatgtgggcggccaggtgacctggaccgcggatgtggagaactat
ctcgggttcagccatgtgaacgccggtgacctcgtggccaggttcgaagaacatgtgaag
accttcggagtggagagggtaatcgggcccgaggtcacctccgtggacctcaccgccaaa
atcaagcgggtggtgaccgacgacgggaaggtgtactccggaaaaacattgatcatcgcc
accgggggcaggcatcggcacatgaacatcgaaggcgagcacgaactcatcgccaagggg
atctcctactgctcgacctgcgatgctccgttgtacgacggggcggacgtggccgtcatc
ggaggcggcaattccgccctcgctgccgccctggacctcatccaaattgcaaacaggatc
tacctggtgtccatgacgccactgaccggggatcctctttaccaggaaaaggtgcagaaa
tccgaaaaggtggagatgttcctcgaatacgtccccgtcagggtccttggcgacaaagcc
gtgcggggggtcgagatccggagccttcagagcggggaagtcagggaattgaccgtcgaa
gggattttcgtcgagatcggcatcctgccgaactcgtctctgtttgtggacacgctggcc
accaatcggagaggcgaaatcctggtggacctggaatgccgcaccggactggcgggggtt
tttgcctgcggggacgtcaccaacgtccctttcaaacaggtggtggtggctgtcggggag
ggcgccaaggcggccctgtccgcgtacagttacctgatcaaccagtag

DBGET integrated database retrieval system