KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0560Help
Entry
SFV_0560          CDS       T00377                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SFV_0560 (ahpF)
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SFV_0560 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C NAD_binding_8 DAO Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ABF02817
UniProt: Q0T709
LinkDB All DBs
Position
588964..590529
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLAQPEKRRHYSECANHGSERR
RQQSRWSGISRSCQRQYHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttaccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccagtg
cgtaagccgtctttcctgatcaccaacccaggttccaaccagggaccacgttttgcaggc
tccccgctgggccacgagttcacctcgctggtactggcgttgctgtggaccggtggtcat
ccgtcgaaagaagcgcagtctctgctggagcagattcgccatattgacggtgattttgaa
ttcgaaacctattactcgctctcttgccataactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtattgaacccgcgcatcaagcacactgcaattgacggcggcaccttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggcagtgttcgtaaacgggaaagag
tttggtcagggccgcatgacgttgactgaaatcgttgccaaaattgatactggcgcggaa
aaacgtgcggcagaagagctgaacaagcgtgatgcttatgacgtattaatcgttggttcc
ggcccggcgggtgcagcggcagcaatttactccgcacgtaaaggcatccgtaccggtctg
atgggcgaacgttttggtggtcagatcctcgataccgttgatatcgaaaactacatttct
gtaccgaagactgaagggcagaagttggcaggcgcactgaaagttcacgttgatgaatac
gacgttgatgtgatcgacagccagagcgccagcaaactgatcccggcagcggttgaaggt
ggtctacaccagattgaaacagcttctggcgcggtactgaaagcacgcagcattatcgtg
gcgacgggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcactaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtagcggtt
atcggcggcggtaactccggcgtggaagcggcaatcgacctggcgggtatcgttgagcac
gtaacgctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaggacaaactt
gcgcagcctgaaaaacgtcgacattattctgaatgcgcaaaccacggaagtgaaaggcga
cggcagcaaagtcgttggtctggaatatcgagatcgtgtcagcggcaatatcacaacatc
gaactggccggtatttttgtccagattggtctgctgccgaacaccaactggctggaaggc
gcagtcgaacgtaaccgcatgggcgagattatcattgatgcgaaatgtgaaaccaacgtc
aaaggcgtgttcgcagcgggtgactgtacgacggttccgtacaagcagatcatcatcgcc
actggcgaaggtgccaaagcctctctgagtgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system