KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2841Help
Entry
SFV_2841          CDS       T00377                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase activity
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00250  Alanine, aspartate and glutamate metabolism
sfv00280  Valine, leucine and isoleucine degradation
sfv00310  Lysine degradation
sfv00410  beta-Alanine metabolism
sfv00640  Propanoate metabolism
sfv00650  Butanoate metabolism
sfv01100  Metabolic pathways
sfv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SFV_2841 (gabT)
   00650 Butanoate metabolism
    SFV_2841 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFV_2841 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SFV_2841 (gabT)
   00310 Lysine degradation
    SFV_2841 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFV_2841 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfv01007]
    SFV_2841 (gabT)
Enzymes [BR:sfv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SFV_2841 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SFV_2841 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     SFV_2841 (gabT)
Amino acid related enzymes [BR:sfv01007]
 Aminotransferase (transaminase)
  Class III
   SFV_2841 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABF04920
UniProt: Q0T195
LinkDB All DBs
Position
complement(2902648..2903907)
Genome map
AA seq 419 aa AA seqDB search
MQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVE
AQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATK
RSGTIAFSGEYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASI
HRIFKNDAAPEDIAAIMIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQSGAGR
TGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVA
ALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGSMIAIELFEDGDHSK
PDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIGQCFDEAKQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcagtcaggcgattccccgtggcgttgggcaaattcacccgattttcgct
gaccgcgcggaaaactgccgggtgtgggacgttgaaggccgtgagtatcttgatttcgcg
ggcgggattgcggtgctcaataccgggcacctgcatccgaaggtggtggccgcggtggaa
gcgcagttgaaaaaactgtcgcacacctgcttccaggtgctggcttacgagccgtatctg
gagctgtgcgagattatgaatcagaaggtgccgggcgatttcgccaagaaaacgctgctg
gttacgaccggttccgaagcggtggaaaacgcggtaaaaatcgcccgcgccgccaccaaa
cgtagcggcaccatcgcttttagcggcgagtatcacgggcgcacgcattacacgctggcg
ctgaccggcaaggtgaatccgtactctgcgggcatggggctgatgccgggtcatgtttat
cgcgcgctttatccttgcccgctgcacggcataagcgaggatgacgctatcgccagcatc
caccggatcttcaaaaatgatgccgcgccggaagatatcgccgccatcatgattgagccg
gttcagggcgaaggcggtttctacgccgcgtcgccagcctttatgcagcgtttacgcgct
ctgtgtgacgagcacgggatcatgctgattgccgatgaagtgcagagcggcgcggggcgt
accggcacgctgtttgcgatggagcagatgggcgtggcgccggatcttaccacctttgcg
aaatcgatcgcaggcggtttcccgctggcgggcgtcaccgggcgcgcggaagtgatggac
gctgttgcaccgggcggtctgggcggcacctatgccggtaacccgattgcctgcgtggct
gcgctggaagtgttgaaggtgttcgagcaggaaaatctgctgcaaaaagccaacgatctg
gggcagaagctaaaagacggattgttggcgatagccgaaaaacacccggagatcggcgac
gtacgcgggctgggatcgatgattgccatcgagctgtttgaagatggcgatcacagcaaa
ccggacgcaaaactcaccgccgagatcgtggcacgcgcccgcgataagggcctgattctt
ctctcctgcggcccgtattacaacgtgctgcgcatccttgtaccactcaccattgaagac
gctcagatccgtcagggtctggagattatcggtcagtgttttgatgaggcgaagcagtag

DBGET integrated database retrieval system