KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3998Help
Entry
SFV_3998          CDS       T00377                                 

Gene name
glpF
Definition
(GenBank) facilitated diffusion of glycerol
  KO
K02440  glycerol uptake facilitator protein
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfv02000]
    SFV_3998 (glpF)
Transporters [BR:sfv02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SFV_3998 (glpF)
Ion channels [BR:sfv04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   SFV_3998 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP Phage_holin_5_2 DUF2613
Motif
Other DBs
NCBI-ProteinID: ABF06003
UniProt: Q0SY62
LinkDB All DBs
Position
complement(4103800..4104444)
Genome map
AA seq 214 aa AA seqDB search
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacatcaaccttgaaaggccagtgcattgctgaattcctcggtaccgggttg
ttgatttttttcggtgtgggttgcgttgcagcactaaaagtcgctggtgcgtcttttggt
cagtgggaaatcagtgtcatttggggactgggggtggcaatggccatctacctgaccgca
ggggtttccggcgcgcatcttaatcccgctgttaccattgcattgtggctgtttgcctgt
ttcgacaagcgcaaagttattccttttatcgtttcacaagttgccggcgctttctgcgct
gcggctttagtttacgggctttactacaatttatttttcgacttcgagcagactcatcac
attgttcgcggcagcgttgaaagtgttgatctggctggcactttctctacttaccctaat
cctcatatcaattttgtgcaggctttcgcagttgagatggtgattaccgctattctgatg
gggctgatcctggcgttaacggacgatggcaacggtgtaccacgcggccctttggctccc
ttgctgattggtctactgattgcggtcattggcgcatctatgggcccattgacaggtttt
gccatgaacccagcgcgtgacttcggtccgaaagtctttgcctag

DBGET integrated database retrieval system