KEGG   Shigella flexneri 8401 (serotype 5b): SFV_4279Help
Entry
SFV_4279          CDS       T00377                                 

Gene name
cycA
Definition
(GenBank) transport of D-alanine, D-serine, and glycine
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfv02000]
    SFV_4279 (cycA)
Transporters [BR:sfv02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SFV_4279 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: ABF06260
UniProt: Q0SXF5
LinkDB All DBs
Position
complement(4425287..4426699)
Genome map
AA seq 470 aa AA seqDB search
MVDQVKVVADDQAPAEQSLRRNLTNRHVQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVV
AITAYAQFWFPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGL
VMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKD
PEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVIN
FVVLTSAASSANSGVFSTSRMLFGLAQEDVAPKAFAKLSKRAVPAKGLTFSCICLLGGVV
MLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCW
VCMAFFVFVVVLLTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAAELRK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcaggtaaaagtcgttgccgatgatcaggctccggctgaacagtcgctacgg
cgcaatctcacaaaccgacatgttcagcttattgccattggaggtgccattggtactggg
ttgtttatggggtccggcaaaacgattagccttgccgggccgtcgatcattttcgtttat
atgatcattggttttatgctctttttcgtgatgcgggcaatgggggaattgctgctttcg
aatctggaatacaaatcttttagtgacttcgcttccgatttactggggccgtgggcggga
tatttcaccggctggacttactggttctgctgggttgtaaccggtatggcagacgtggtg
gcgatcacggcttatgctcagttctggttccccgatctctccgactgggtcgcctcgctg
gcggtgatagtgctgctgctgacgctcaaccttgccaccgtgaaaatgttcggtgagatg
gagttctggtttgcgatgatcaaaatcgtcgccatcgtgtcgctgattgtcgtcggcctg
gtcatggtggcgatgcactttcagtcaccgaccggtgtggaagcgtcattcgcgcatttg
tggaatgacggcggctggttcccgaaaggtttaagtggcttctttgccggattccagata
gcggttttcgctttcgtggggattgagctggtaggtacaacagctgcggaaaccaaagat
ccggagaaatcactgccacgcgcgattaactccattccgatccgtatcattatgttctac
gtcttcgcgctgattgtgattatgtccgtgacaccgtggagttcggtagtcccggagaaa
agcccgttcgttgagctgtttgtgttggtaggtttgcctgcggctgccagcgtgatcaac
tttgtggtgctgacctctgcggcgtcttccgctaacagcggtgtcttctctaccagccgt
atgctgtttggtctggcgcaggaagatgttgcgccgaaagcgttcgctaaactttctaag
cgcgcagtacccgcgaaagggttgaccttctcgtgtatctgtctgctcggcggcgtggtg
atgttgtatgtgaatcctagcgtgattggcgcgttcacgatgattacaaccgtttccgcg
attctgtttatgttcgtctggacgattatcctttgctcgtacctggtgtaccgcaaacag
cgtcctcatctgcatgaaaagtcgatctacaagatgccgctcggcaagctgatgtgctgg
gtatgtatggcgttctttgtgttcgtggtcgtgttgctgacactggaagatgacactcgc
caggcgctgctggttaccccgctgtggtttatcgcgctggggttgggctggctgtttatt
ggtaagaagcgggctgctgaactgcggaaataa

DBGET integrated database retrieval system