KEGG   Serratia fonticola DSM 4576: WN53_01690Help
Entry
WN53_01690        CDS       T04030                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00061  Fatty acid biosynthesis
sfw00780  Biotin metabolism
sfw01100  Metabolic pathways
sfw01212  Fatty acid metabolism
Module
sfw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WN53_01690
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WN53_01690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfw01004]
    WN53_01690
Enzymes [BR:sfw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     WN53_01690
Lipid biosynthesis proteins [BR:sfw01004]
 Fatty acid synthase
  Component type
   WN53_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AKG67957
UniProt: A0A0F7H7W3
LinkDB All DBs
Position
complement(396699..397154)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLDIAEILELLPHRYPFLLVDRVLDFEEHKYLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctagatattgcagaaattctggaactgcttcctcaccgt
tatccattcttgctggttgaccgtgtattggatttcgaagagcataaatatctgcgtgca
gtgaagaacgtatccgttaatgagccgtttttccaggggcatttccctggtaaaccgatt
tttccaggcgtgctgattttggaagctatggctcaggccacgggtatcctggcatttaag
agcgtgggtaaactggaaccgggcgagctgtactatttcgccggtattgacgaagctcgc
ttcaagcgccctgtggtgcctggcgatcagatgattatggaagtcactttcgagaaaacc
cgtcgtggtctgacccgctttaaaggcgtggcgaccgtcgatggaaaaattgtctgcgaa
gcaaccatgatgtgtgcccgcagccgggaggcataa

DBGET integrated database retrieval system