KEGG   Serratia fonticola DSM 4576: WN53_04485Help
Entry
WN53_04485        CDS       T04030                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00250  Alanine, aspartate and glutamate metabolism
sfw00410  beta-Alanine metabolism
sfw00640  Propanoate metabolism
sfw00650  Butanoate metabolism
sfw01100  Metabolic pathways
sfw01120  Microbial metabolism in diverse environments
Module
sfw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WN53_04485
   00650 Butanoate metabolism
    WN53_04485
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WN53_04485
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WN53_04485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfw01007]
    WN53_04485
Enzymes [BR:sfw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WN53_04485
Amino acid related enzymes [BR:sfw01007]
 Aminotransferase (transaminase)
  Class III
   WN53_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKG68435
UniProt: A0A0F7D163
LinkDB All DBs
Position
complement(1036807..1038072)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRLAATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYISLAERINQRAPIEGTCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVSTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRTLCDQHGILLIADEV
QTGFARTGKLFAMDHYAVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIEEEQLCQRSQRLGQHLVEVLQQARSHCPAIVDIRALGSMVAVEFND
PATGKPSPEFTRQVQQKAQEEGLLLLSCGVNGNVIRFLYPLTIPDAQFNQALAILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtctggccgctaccccaagagggattggcgtg
atgtgtggtttttacgccgagcgtgcagaaaatgccaccctgtgggatgtggaaggcaat
gaggtgatcgactttgcctcgggcattgcggtgcttaataccggccaccgtcatcccaag
gtgatcgccgccattgaaaagcagctccaggcgtttacccatacggcataccagatcgtt
ccttatgaaagctatatttcgctggcagagcgcatcaaccaacgcgctccaatcgaaggc
acctgtaaaaccgccttcttcaccaccggtgcagaagcggtagaaaatgcggtgaagatc
gcccgcgcatacacagggcgtccaggcctgatcaccttcggcggcggattccatggccgt
acctatatgaccatggcgctgacgggtaaagtggccccttacaagctgggctttggcccg
ttccctggctccgttttccacggccagtatccgaatgcgttatatggtgtcagcaccgaa
gatgccatgaacagcctggaacgcatctttaaggccgatatcgatcccaagcaggttgcc
gcgatcgtactggagccggtgcagggtgaagggggctttaacgtggctccggcagaattc
atgcaggcgctgcgtacgctgtgtgaccaacacggtatcctgttgatcgccgatgaggtg
caaactggctttgcccgtaccggcaagctgtttgcgatggaccactatgcggtgaaaccg
gacctgatcaccatggcgaagagcctggctggcggtatgccgctgtctgccgtggcgggc
cgtgctgaagtgatggatgccccagcccccggcggccttggcggtacctacgccggtaac
ccattagccgttgctgccgcgttggcggtattggacgtaattgaagaagagcagctgtgc
caacgctctcagcgtttggggcaacatttggtggaagtgctgcaacaggcacgtagccac
tgcccggcgattgtggatattcgcgcgctgggttccatggtggcagtagagttcaacgac
ccggcaaccggtaaaccgtcgccggagtttacccgtcaggtacagcaaaaagcccaggaa
gaaggactgttgctactcagctgtggggtgaacggtaacgtgatccgtttcctgtacccg
ctgaccattcctgatgcccagtttaaccaggcgctggcaatcctttcccgcgcgctggcc
caataa

DBGET integrated database retrieval system