KEGG   Serratia fonticola DSM 4576: WN53_06360Help
Entry
WN53_06360        CDS       T04030                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00564  Glycerophospholipid metabolism
sfw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WN53_06360 (glpD)
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WN53_06360 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKG68783
UniProt: A0A0F7H8J3
LinkDB All DBs
Position
1429946..1431454
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLRFGPDSVLKPDLKRGFEYSDCWVDDARLVVLNAQAVAERGGEVRTRTKVTRAWRENG
LWMVEAIDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWLDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIDGDRDSYAAKLRRQHGWMTESLARRYART
YGSHSKIILANANSLSDLGEDFGHDLYEAELRYLVEKEWVVELDDALWRRTKLGMWLSEE
QQARVKTWLAENAKPKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggtggtatcaacggagccggcatcgcagcc
gatgcagccgggcgtgggctgtccgtactgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagttcaaaactgatccacggtggcctgcgctacctggaacactacgag
tttcgtctggtcagcgaagcgctggccgaacgtgaagtgctgctgaaactggcaccacac
atcgccttcccaatgcgtttccgcctgccgcaccagccccatctgcgcccggcctggatg
atccgcatcggcctgttcctgtacgatcatttgggcaaacgcaccagcctgccaggcagt
aagggtttgcgctttggaccagactccgtcctgaagccggacttaaagcgcggtttcgaa
tattctgactgttgggtagacgatgcgcgcctggtcgtgctgaatgcccaagccgtggcc
gaacgcggtggcgaagtacgcacccgcaccaaagtgacccgcgcctggcgcgaaaatggc
ctgtggatggtggaagccatcgacgtcgacagcggcaaaacctttacctggcgcgccaaa
ggcctggtaaacgccaccggcccatgggtaaaacatttcttcgacgatggcctgaagctc
aagtctccttacggtatccgcctgatcaaaggcagccatatcgtggtacctcgggcacat
aaccagccacagtcttatatcttgcagaacgaagaccaccgtatcgtgtttgtcattccg
tggctggacgagttctccatcatcggcaccaccgacgtggaataccacggcgatccgaaa
gacgtgaagatcgacgataacgaaatcaactatctgttgaaggtgtataacgatcacttc
aaaaaacagctgggccgtgacgatatcgtctggacctactctggcgtacgcccactgtgt
gatgacgaatctgactcaccgcaggccgtaactcgcgactatacgctggatgtgcatgac
gagcagggcaaagccccactgctttccgtgtttggtggcaaactcaccacttaccgcaaa
ctggccgagcatgcgatggagaagttggctcactactatcctggctgtggcccggcgtgg
accaaaaacggttccctgccagggggcgatattgacggcgatcgcgatagctatgccgct
aaactgcgccgtcagcacggctggatgacggagtctctggctcgccgttacgctcgcacc
tatggcagccacagcaaaattatcttggccaatgccaatagcctgagcgatttgggtgaa
gacttcggccatgacctgtacgaggctgaactgcgttatctggtagagaaagagtgggtt
gtcgagctggatgatgccttgtggcgccgtaccaaactggggatgtggctcagcgaagaa
cagcaggcacgggtgaaaacctggctggcagaaaatgccaaaccaaaagcgttgtcattg
gcgtcttga

DBGET integrated database retrieval system