KEGG   Serratia fonticola DSM 4576: WN53_06955Help
Entry
WN53_06955        CDS       T04030                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00620  Pyruvate metabolism
sfw00680  Methane metabolism
sfw01100  Metabolic pathways
sfw01120  Microbial metabolism in diverse environments
sfw01200  Carbon metabolism
Module
sfw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WN53_06955
  09102 Energy metabolism
   00680 Methane metabolism
    WN53_06955
Enzymes [BR:sfw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WN53_06955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKG68888
UniProt: A0A0F7H9Z6
LinkDB All DBs
Position
1575006..1577642
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPHGEAASNPEALAQLFTKLKDNKLDNKQ
LQKAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRE
LAGGDEVQEPYRELMKQLRSQLMSSQAYLEGRLKGERVLRPHDLLENNEQLWEPLYACYQ
SLVACGMSIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCKVVAEAPQGSIAAYVISMARTPS
DVLAVHLLLKETGCPFALPVAPLFETLDDLNNAEDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAVLEANLLPPPEPKPEWRTLMDELS
ETSCNMYRGYVRENPEFVPYFRAATPEQELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQDQLEAMCHNWPFFSTRIAMLEMVYAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLASDIKAVLTIANDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaactgctaggc
gataccattaaagaagcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgccggtaacgaggcgcatcgtcaggagctgctctccacgctg
cagaacctgtccaacgatgagctgctgcccgttgcccgcgccttcagccaattcctcaac
ctgaccaacgttgccgagcaataccacagcatctcaccgcacggcgaagcggccagcaac
ccggaagccttggcgcagttgtttaccaagctgaaagacaacaagctggataacaaacag
ctgcaaaaggcggtggacgatctttccatcgagctggtcctgaccgctcacccaacggaa
attacccgccgcaccctgatccacaagctggttgaggtgaacacctgtctgagccagctg
gatcataacgacctggccgactacgagcgtaataaaatcatgcgccgtctacgccagttg
gtcgcgcaatcctggcataccgacgagatccgcaaaaatcgtccatccccggtcgatgaa
gccaaatggggctttgccgtggtggaaaacagcctgtgggaaggcgtaccggctttcctg
cgcgagttcaacgaacagttggaaaactccatcgattaccgcctgccggtagaagccgta
cctatccgcttcacctcctggatgggtggcgaccgcgacggtaacccgaacgtgaccgct
gaaatcacccgtcacgtgctgttgctgagccgctggaaggcctgcgatctgttcacccgt
gatattcaggtgctggtctccgagctgtcgatgaccgaatgtactcctgagctgcgcgaa
cttgccggcggtgacgaagtacaagaaccttatcgcgaattgatgaagcaactgcgcagc
cagttgatgagctcccaggcctatcttgaaggccgcctgaaaggcgaacgcgtcctgcgt
ccacacgacctgctggaaaataacgagcagttgtgggaaccgctgtacgcctgctaccaa
tctttggtggcctgtggcatgagcattattgccaacggccaactgctggacacgctgcgc
cgcgtacgctgctttggcgtaccgctggtgcgtatcgacgtgcgccaggaaagcactcgc
cataccgaagccattgccgaactgacccgctatctgggcctgggggattatgagagctgg
tcagaagccgacaaacaggcattcctgatccgtgagctgaactccaagcgtccgctggtg
ccactgaagtgggagccgagtgcagacactcaggaagtgctggaaacctgcaaggtggtc
gccgaagcgccacaaggttcgatcgccgcctacgtcatttccatggctcgtaccccgtcc
gacgtcttggccgtgcacctgttgttgaaggagactggttgcccattcgcgctacctgtg
gccccactgttcgaaaccctcgacgatctgaacaacgccgaagacgtgatgacccagttg
ctgaacatcgactggtatcgcggctttattcagggcaaacagatggtcatgatcggctat
tccgactcggcaaaagatgctggcgtgatggctgcctcctgggcgcaataccgtgcacag
gacgcactgatcaaaacctgtgagaaggccggagtggcgctaacgctgttccatggccgt
ggtggctcaattggccgtggtggcgcacctgcgcacgccgctctgctctcacaaccacca
ggcagcctgaaaggtggcctgcgcgtgaccgaacagggcgagatgatccgctttaaattc
ggcctgccagaagtcaccatcagcagcctggcgctgtacgccggtgcggtgttggaagcc
aacctgttgccaccgccggagcctaagccagaatggcgcacgctgatggatgaactgtcc
gaaacctcgtgcaacatgtatcgcggttacgtgcgtgaaaacccagaatttgtaccttac
ttccgcgccgctacgccagagcaggaactggggaaactgccattgggttcacgcccggcc
aaacgccgcccgaacggcggtgttgaaagcctgcgcgctatcccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccagcctggctgggtgccggtgctggcctgcaggaagcg
gtgaaagctggcaagcaggaccagttggaagccatgtgccacaactggccgttcttctct
acccgtatcgcgatgctggaaatggtatacgccaaagccgacctgtggctggcggaatac
tacgatcagcgtctggtagacaagtccctgtggccgctcggccaacagttgcgtgatcaa
ttggccagcgatatcaaggcggtgctgactattgccaacgacgaccatctgatggaagac
ctgccgtggatcgccgaatctatcgcgttgcgcaacgtctacaccgacccgctaaacgta
ttgcaggccgagctgctgcaccgttcgcgccagcaggagcatccggatgcccgcgttgag
caggctctaatggtcactattgctggcgtggcggccgggatgcgcaacaccggctaa

DBGET integrated database retrieval system