KEGG   Serratia fonticola DSM 4576: WN53_13865Help
Entry
WN53_13865        CDS       T04030                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00473  D-Alanine metabolism
sfw01100  Metabolic pathways
sfw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WN53_13865
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    WN53_13865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfw01011]
    WN53_13865
Enzymes [BR:sfw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WN53_13865
Peptidoglycan biosynthesis and degradation proteins [BR:sfw01011]
 Precursor biosynthesis
  Racemase
   WN53_13865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKG70095
UniProt: A0A0F7D245
LinkDB All DBs
Position
complement(3133326..3134555)
Genome map
AA seq 409 aa AA seqDB search
MPLHLRHLVLIPLLTLVACHQPTATNPTHSLAATAKSSPAVISNARLEISQSALEYNTHK
IQQLLGDKTTLCAILKGDAYGHDLSLVAPVMIKNHVQCIGVASNQELQTVRELGFKGRLM
RVRNATEAEMRQATDYDTEELIGNLEMAKRLDAIAAQQGKTLRFHLALNSGGMSRNGLEV
SEAAGLAEAKAISALPHLKMVGIMSHYPEEDAAAVRKDLARFKVQSQQVLDITGIKRSDV
TLHVANTFATLTVPESWLDMVRVGGVFYGDTIASNDYKRVMTFKSSIAALNHYPKGNTVG
YDRTYTLKRDSLLANIPVGYADGYRRVFSNAGHVLIQGQRVPVVGKTSMNTVMVDVTDVK
GVTPGDEVVFFGKQGNAEITATEVEDISGALFTEMSILWGATNKRVLVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccgctacatttacgccatttagtcttaataccgctattaacgttggtggcttgccat
caacctactgccaccaaccccactcattccctcgccgctacggctaaaagttcaccagca
gtaatcagcaatgcccggttggaaatctcacaaagcgcgctggaatataacacccacaag
attcagcaactgttgggcgataaaactaccctttgcgccattttgaaaggcgatgcctac
gggcacgacctttcgctggtggcacccgtgatgatcaaaaatcacgtgcagtgtattggc
gtggctagtaaccaagagctgcaaaccgtgcgcgaactcggctttaaaggccgcctgatg
cgcgtgcgcaatgccaccgaagcagaaatgcgccaggctaccgactatgacaccgaagag
ctgatcggtaatctggaaatggcgaagcgcctggatgccattgccgcccagcagggcaaa
accctacgttttcatttggcactgaactctggcggcatgtcacgtaacggcctggaagtc
agcgaagctgccggattggctgaagccaaggctatctctgcattacctcatctgaaaatg
gtcggcatcatgtcccactatcctgaggaagatgcagcagcggtgcgcaaggatcttgcc
cgctttaaggtgcaatcccagcaggtgctagacattaccgggatcaaacgcagcgacgtg
accttacacgttgctaatacctttgcgaccctcaccgtaccagagtcctggcttgatatg
gtgcgcgttggcggggtgttttatggcgataccattgccagtaacgactataaacgcgtg
atgaccttcaagtcatccatcgcggcactcaaccattaccctaaaggcaatactgtcggt
tacgatcgtacctacaccctgaaacgcgattcgctattggctaatatccctgtgggctat
gccgacggctatcgccgggtattcagcaacgcgggtcatgtgctgatccaggggcagcgg
gttccggtagtgggcaaaacctcgatgaataccgtgatggtggatgtgaccgacgtgaaa
ggcgtcactcctggtgatgaggtggtgttcttcggcaagcagggtaatgcagaaatcacc
gccactgaagtcgaagacatcagcggtgcactgtttaccgagatgtcgatcctctggggc
gcgaccaataagcgcgtgttggtggattga

DBGET integrated database retrieval system