KEGG   Serratia fonticola DSM 4576: WN53_14050Help
Entry
WN53_14050        CDS       T04030                                 

Definition
(GenBank) ATP-dependent dsDNA exonuclease
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
sfw  Serratia fonticola DSM 4576
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfw03400]
    WN53_14050
DNA repair and recombination proteins [BR:sfw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     WN53_14050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_29 AAA_15 Bac_DnaA cobW AAA_21 ABC_tran NTPase_1 TsaE MMR_HSR1 AAA_22 GTP_EFTU AAA_25 RsgA_GTPase AAA
Motif
Other DBs
NCBI-ProteinID: AKG70130
UniProt: A0A0F7D252
LinkDB All DBs
Position
complement(3169195..3172446)
Genome map
AA seq 1083 aa AA seqDB search
MKILSLRLKNLNSLQGEWKIDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHQTPR
LEVSASQNELMTRHTAESLAEVEFEVKGVGYRAFWSQRRAKNDPDGNLQAPKVELALRAD
GKILADKISDKKELIAAITGLDFGRFTKSMMLSQGQFAAFLNAKANERAELLEELTGTEI
YGRLSAQVFEQHKQAKSDLDALHHRASGIELLNDEQRQALESQLNELGTEEQLLNQQSQR
QQHQLSWLQRWQTTQQQTQEYQQQLAGVQQEFQLAEPQLQRLARSEPAEKLRPLLNERNR
CQRDRLALQQQIEQLAQQQERQLAELTPLQQQLEQAQKARQAQAEHQQQQQTLMDDKVLP
LDHQIAQLQNQLAEARKQLAESQRQSEELRRTLEQLTERRGQLATLAGQYQTRQLELTAA
LDSQLQQQITLEAQSPLEKLRHRQAELSGLRPVRQQLSKLALLFQQNQQRLEQQRLEFTT
RQKQLTEVETQLDAVRQQYKQQKAHLTDVEKTLELEKRIVSLEAERARLQTDAPCPLCGS
THHPAIEQYQAVKPSETEQRVAQLRTQTEELHTQGTELRARSESLKEQQQRLQTQLNQEL
EQQENHLQSWQTLSAPLAFDFTLQDSARLTAWLEACDSEEQAAQQLLLQHERLAKSVQLA
KDALNALQTEQQSSQQETARLNERFDLLQKNQQETQRQLAHWQQQCLTNETQLLAQRNER
TALFGERTVAEAREQLRTAQIAAENALQQATERLHKAQEQRDRLAGQWVGLQQQQQQQAE
RGQQAEQQWQQALASSTFDDEAAFNAALLDDDERQRLQQHKEQLQERQVRATTLLAQAVQ
ALEQHRLERPADLDETQANIEQLTTALSELAERLKTLQLRQGEVRNQLSSDAERRLNQQS
LFEQIAQSQQQYDDWSLLNQLIGSKEGDKFRKFAQGLTLDHLVYLANNQLGRLHGRYLLQ
RKTSDALELQVVDTWQADALRDTRTLSGGESFLVSLALALALSDLVSHKTSIDSLFLDEG
FGTLDAETLDTALDALDSLNATGKTIGVISHVEAMKERIPVQIKVKKVNGLGVSRLDAQF
RIE
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgagcctaaggctgaaaaacctgaactcgctacagggcgagtggaaaatc
gacttcacggcggaacccttcgccagcaacggcctgtttgccatcaccggccccaccggc
gcgggtaaaaccaccctgctggatgccatctgtctggctctctatcaccagacgccgcgg
ctggaagtcagcgccagccagaacgaattgatgacccgccacaccgccgaatcgctggcc
gaggtggagtttgaggtcaaaggtgtcggctatcgcgccttctggagccaacgccgggcg
aaaaacgatccggacggcaacctgcaggctcccaaggtggagctggcactgcgggcagac
ggcaaaatccttgcggataaaatttccgataaaaaagagctgattgccgcgatcaccggg
ctggattttggccgcttcaccaaatcgatgatgctgtcgcagggccagtttgccgccttc
ctgaacgccaaggccaacgaacgtgccgaactgctggaagaactgaccggcaccgagatt
tatgggcggctgtcggcacaggtattcgaacagcacaaacaggcgaaaagcgatctggac
gctttgcatcaccgtgccagcgggattgaactgctcaatgatgagcaacgtcaggcgctg
gaaagccagctcaacgaactcggtactgaagagcagcttctcaaccaacaatcacaacgg
caacaacatcagctgagctggctgcaacgctggcaaaccacccagcaacagactcaggaa
taccagcaacaactggctggcgtgcaacaggagtttcaactggccgaaccgcagttgcaa
cggttagcccgcagtgagcctgccgagaaactgcgcccgttgctcaatgagcgtaatcgt
tgtcagcgggatcgtttagcattgcagcaacagatcgaacagttggctcagcagcaagag
cggcaattggccgaactgaccccgttacaacagcagttggagcaggcgcaaaaggccagg
caagcccaggcggaacatcagcaacagcagcagacgctgatggatgacaaggtgttgccg
ctcgatcatcagattgctcagttgcaaaaccaactggcagaagcgcgtaaacagcttgcg
gagagccagcggcagagcgaagagctgcggcgcacgctggaacaactcaccgaaagacgc
ggccaactggctaccctggcgggtcaatatcagaccaggcagcttgaactcacggcggcg
ttggatagccaactccagcagcaaatcacgttagaggcgcaatccccactggagaaactg
cgtcaccgccaggccgaactgagtggcttgcgcccggttcgccagcagttgtcaaaactg
gccttactgttccagcagaaccagcaacgccttgagcagcagcggctcgaattcactacg
cgacaaaaacagctgaccgaagtagaaactcaactcgatgcggtgcgccagcagtataaa
cagcaaaaagcgcacctgacagacgttgagaagacgctcgaactggaaaagcgcatcgtc
agtctggaagccgaacgggcgcggctgcaaaccgatgctccctgcccgctgtgcggctcc
acgcaccatccggcgatcgagcaatatcaggctgtcaaaccgtcagaaacggaacagcgc
gtcgcccagttacgcacccaaaccgaagaactgcacactcaagggacagagctgcgcgca
cgcagtgaaagcctgaaagagcagcagcaacggctgcaaacgcagttgaaccaggaactt
gagcagcaggaaaaccatctacaaagctggcagaccctcagcgcccccttggccttcgac
tttacgctgcaagacagcgcccggttaaccgcctggctggaggcttgcgatagtgaagag
caggccgctcagcagcttctgttgcaacacgaacggctcgccaaatccgtacagcttgcg
aaggatgccctgaatgccctgcaaactgaacagcagagttcgcaacaggaaacggcgcgg
ctgaatgaacgctttgatctgctgcagaaaaaccagcaggaaacccagcgccaattggca
cactggcaacagcagtgcctgacgaatgaaactcagctgctggcacagcgtaacgaacgc
accgcgttgtttggtgagagaacggtggctgaagcccgcgagcaattgcgcacggcacaa
atcgccgcagagaacgccttgcagcaggctacggagcgattgcacaaagcccaagagcag
cgcgatcgtctggctggtcaatgggtcggtttgcagcaacagcagcaacagcaagccgaa
cgggggcaacaggccgagcaacagtggcagcaggccttggccagcagcaccttcgacgat
gaggccgcattcaacgccgcgctactggatgacgacgaacgccagcgcttacagcagcac
aaagagcagttgcaggagcgtcaggtgcgggccacaacgctgttggcgcaggccgtacag
gctctggagcagcaccgtctggagcgccctgcagatctggatgaaacccaggccaatatt
gagcaactcaccaccgcgctcagcgaactggcagagcggctgaaaacactacagctgcgt
cagggcgaggtgcgcaaccaactgagcagcgatgccgagcgccgcctcaatcaacagtcc
ctgttcgaacagatcgcccaaagccaacagcagtatgacgactggagcctgctcaaccag
cttatcggctccaaagagggcgacaagttccgcaaattcgctcagggcctgaccctggat
catctggtgtacctggccaacaaccagcttggccgcctgcacgggcgctatctgttgcaa
cgcaaaaccagtgatgcgctggagctacaggtggtggatacctggcaggccgatgccctg
cgcgatacccgcaccctttccggcggtgaaagcttcctggtgagtctggcgctagcgctg
gccttgtccgatctggtcagccacaagaccagcatcgattcgctgttcctggacgagggc
ttcggcacgctggacgccgagacgctggacaccgcgctagatgccttggacagccttaac
gccaccggcaaaaccatcggcgtgatcagccacgtggaggcaatgaaggagcgcatcccg
gtacagattaaggtgaaaaaggtcaatgggctgggggtcagtcgactggacgctcagttt
cgcatcgaatga

DBGET integrated database retrieval system