KEGG   Serratia fonticola DSM 4576: WN53_15270Help
Entry
WN53_15270        CDS       T04030                                 

Definition
(GenBank) xyla
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00040  Pentose and glucuronate interconversions
sfw00051  Fructose and mannose metabolism
sfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WN53_15270
   00051 Fructose and mannose metabolism
    WN53_15270
Enzymes [BR:sfw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     WN53_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AKG70359
UniProt: A0A0F7HBV5
LinkDB All DBs
Position
complement(3438596..3439576)
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGANLYWPELKGKPSVSQMIERAGTVKGLTHLDLNYPQHINEDVKT
MSQKIEAAGLAVNGMQMRWDAPEFKIGAFTNPDPKIRRQAIELTKRGIDAGREFGASLMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVAEYAPDVDISIEYKPNEPRAYSIFPNVTTC
LLAVEEAGCANLGITLDFAHVLFANEIPAFAAAMVARRSRLMGLDLNDGWGKRDDGLMVA
SVNPRATLEFLWQMQRDGYTGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCKQLDNN
PELMSAISKQDAVASQQIVNDIMLAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttaaattcgccacccgtttgaactcctttgcctcaggagccaatctttac
tggccagaactaaaaggcaaaccctctgtatcgcaaatgattgagcgggccggaacggtc
aagggattgacccacctggatttaaactaccctcagcacatcaatgaggatgtcaaaacc
atgagccaaaagatcgaagcggctggcctggcggtgaatggcatgcaaatgcgctgggat
gcgccagaattcaagattggggcgttcaccaatccggacccaaaaatccgccgccaggcg
atcgaactgaccaagcgtgggatagatgcgggccgtgagtttggtgccagtttaatgacc
ctgtggatgggccaggatggttttgattattgcttccaggcagattacaaaaaaatctgg
gaagacgccgtctccgcggtacgtgaagtggccgaatatgctccagatgtcgatatcagt
atcgaatacaaacctaatgagccacgggcctacagcatttttcccaacgtcaccacctgc
ctgctggcggttgaagaagctggctgtgcgaatctgggtatcacgctcgactttgcccac
gtgctgtttgccaacgagatcccggcctttgccgccgccatggtcgcccgccgctctcgc
cttatgggtcttgatctgaacgatggttggggcaaacgcgacgatggcctgatggtggct
tcggtcaacccacgggcgacgctggaattcctctggcagatgcagcgtgacggctacacg
ggggcttactattttgacaccttcccagacgccagcggcctggatccggtgcgtgaagcc
gaaaccaatatcgcaacggtgacccgcctgctgaaactgtgcaagcagctcgacaataac
cctgagttgatgagcgccatcagcaagcaagacgccgttgcctcacagcaaattgttaac
gacatcatgctggcgaaatag

DBGET integrated database retrieval system